• Gene id: 90459

Gene Summary

• Gene Symbol: ERI1   Gene   UCSC   Ensembl
• Aliases: 3'HEXO, HEXO, THEX1
• Gene name: exoribonuclease 1
• Alternate names: 3'-5' exoribonuclease 1, 3' exoribonuclease, 3'-5' exonuclease ERI1, enhanced RNAi three prime mRNA exonuclease homolog 1, histone mRNA 3' end-specific exonuclease, histone mRNA 3'-end-specific exoribonuclease, histone mRNA 3'-exonuclease 1, three prime histone ,
• Gene location: 8p23.1 (8892224: 9100261)     Exons: 19     NC_000008.11
• OMIM: 608739

Protein Summary

• Protein general information: Q8IV48  
  • Name: 3' 5' exoribonuclease 1 (EC 3.1. . ) (3' 5' exonuclease ERI1) (Eri 1 homolog) (Histone mRNA 3' end specific exoribonuclease) (Histone mRNA 3' exonuclease 1) (Protein 3'hExo) (HEXO)
  • Length: 349  
  • Mass: 40064
• Sequence:

  MEDPQSKEPAGEAVALALLESPRPEGGEEPPRPSPEETQQCKFDGQETKGSKFITSSASDFSDPVYKEIAITNGC
  INRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNFADSYYDYICIIDFEATCEEGNPPEFVHE
  IIEFPVVLLNTHTLEIEDTFQQYVRPEINTQLSDFCISLTGITQDQVDRADTFPQVLKKVIDWMKLKELGTKYKY
  SLLTDGSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSK
  NIARIAVRMLQDGCELRINEKMHAGQLMSVSSSLPIEGTPPPQMPHFRK

• Structural information:
  • Protein Domains: (76..11-)
    (/note="SAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00186-)
    (130..30-)
    (/note="Exonuclease"-)
  • Interpro: IPR013520  IPR012337  IPR036397  IPR003034  IPR036361  
  • Prosite: PS50800
  • PDB: 1W0H 1ZBH 1ZBU 4L8R 4QOZ
  • PDBsum: 1W0H 1ZBH 1ZBU 4L8R 4QOZ
  • DIP: 61409
  • STRING: ENSP00000429615
• Other Databases: GeneCards:  ERI1  Malacards:  ERI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000467	exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0000738	DNA catabolic process, exonucleolytic	IBA	biological process
GO:0005730	nucleolus	IBA	cellular component
GO:0000175	3'-5'-exoribonuclease activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006259	DNA metabolic process	IBA	biological process
GO:0071207	histone pre-mRNA stem-loop binding	ISS	molecular function
GO:0071204	histone pre-mRNA 3'end processing complex	ISS	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0000175	3'-5'-exoribonuclease activity	TAS	molecular function
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008408	3'-5' exonuclease activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0008408	3'-5' exonuclease activity	IDA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0071044	histone mRNA catabolic process	IMP	NOT|biological process
GO:0019843	rRNA binding	ISS	molecular function
GO:0031125	rRNA 3'-end processing	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0043022	ribosome binding	ISS	molecular function
GO:0005730	nucleolus	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R