• Gene id: 90441

Gene Summary

• Gene Symbol: ZNF622   Gene   UCSC   Ensembl
• Aliases: ZPR9
• Gene name: zinc finger protein 622
• Alternate names: zinc finger protein 622, zinc finger-like protein 9,
• Gene location: 5p15.1 (16465799: 16451518)     Exons: 6     NC_000005.10
• OMIM: 608694

Protein Summary

• Protein general information: Q969S3  
  • Name: Zinc finger protein 622 (Zinc finger like protein 9)
  • Length: 477  
  • Mass: 54272
  • Tissue specificity: Expressed in lung, kidney, spleen, liver and brain with lowest expression in kidney. {ECO
• Sequence:

  MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKK
  FASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPA
  PAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTE
  AMDDVVEQDAEEEEAEEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVG
  VGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLE
  YDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYRALGWTGSTGAALMRERDMQYVQR
  MKSKWMLKTGMKNNATKQMHFRVQVRF

• Structural information:
  • Interpro: IPR003604  IPR041661  IPR040025  IPR022755  IPR036236   IPR013087  
  • STRING: ENSP00000310042
• Other Databases: GeneCards:  ZNF622  Malacards:  ZNF622

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:0042273	ribosomal large subunit biogenesis	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0033674	positive regulation of kinase activity	IDA	biological process
GO:0008631	intrinsic apoptotic signaling pathway in response to oxidative stress	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray