• Gene id: 90427

Gene Summary

• Gene Symbol: BMF   Gene   UCSC   Ensembl
• Gene name: Bcl2 modifying factor
• Alternate names: bcl-2-modifying factor,
• Gene location: 15q15.1 (40108878: 40087889)     Exons: 6     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL
• OMIM: 602127

Protein Summary

• Protein general information: Q96LC9  
  • Name: Bcl 2 modifying factor
  • Length: 184  
  • Mass: 20508
  • Tissue specificity: Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells. {ECO
• Sequence:

  MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSP
  ASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQ
  QHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR

• Structural information:
  • Interpro: IPR028192  
  • STRING: ENSP00000346697
• Other Databases: GeneCards:  BMF  Malacards:  BMF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0016459	myosin complex	IBA	cellular component
GO:0010507	negative regulation of autophagy	IBA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0043276	anoikis	IDA	biological process
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0031334	positive regulation of protein-containing complex assembly	ISS	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0010507	negative regulation of autophagy	IDA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0016459	myosin complex	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0016459	myosin complex	IBA	cellular component
GO:0010507	negative regulation of autophagy	IBA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0043276	anoikis	IDA	biological process
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0031334	positive regulation of protein-containing complex assembly	ISS	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	ISS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0010507	negative regulation of autophagy	IDA	biological process
GO:0034644	cellular response to UV	IDA	biological process
GO:0016459	myosin complex	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881