|
Gene id |
90417 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
KNSTRN Gene UCSC Ensembl |
|
Aliases |
C15orf23, HSD11, SKAP, TRAF4AF1 |
|
Gene name |
kinetochore localized astrin (SPAG5) binding protein |
|
Alternate names |
small kinetochore-associated protein, TRAF4 associated factor 1, kinastrin, kinetochore-localized astrin-binding protein, putative TRAF4-associated factor 1, small kinetochore associated protein, small kinetochore-associated protein, kinetochore-localized astri, |
|
Gene location |
15q15.1 (40382720: 40394287) Exons: 9 NC_000015.10
|
|
OMIM |
614718 |
Protein Summary
|
| Protein general information
| Q9Y448
Name: Small kinetochore associated protein (SKAP) (Kinetochore localized astrin binding protein) (Kinastrin) (Kinetochore localized astrin/SPAG5 binding protein) (TRAF4 associated factor 1)
Length: 316 Mass: 35438
Tissue specificity: Widely expressed, including in skin. {ECO
|
| Sequence |
MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPGVQPCR LVTMTSVVKTVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKA TDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELLEKFRDNCLAILESKG LDPALGSETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQMEELQALKVKLEMKEERVRFLEQQTLCNNQV NDLTTALKEMEQLLEM
|
| Structural information |
|
| Other Databases |
GeneCards: KNSTRN  Malacards: KNSTRN |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0001726 |
ruffle
|
IDA |
cellular component |
GO:0051010 |
microtubule plus-end bind ing
|
IDA |
molecular function |
GO:0035371 |
microtubule plus-end
|
IDA |
cellular component |
GO:0042803 |
protein homodimerization activity
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0016477 |
cell migration
|
IMP |
biological process |
GO:0000226 |
microtubule cytoskeleton organization
|
IMP |
biological process |
GO:0071364 |
cellular response to epid ermal growth factor stimu lus
|
IMP |
biological process |
GO:0000776 |
kinetochore
|
IDA |
cellular component |
GO:0072686 |
mitotic spindle
|
IDA |
cellular component |
GO:0035371 |
microtubule plus-end
|
IDA |
cellular component |
GO:0051988 |
regulation of attachment of spindle microtubules t o kinetochore
|
IMP |
biological process |
GO:0007051 |
spindle organization
|
IMP |
biological process |
GO:0007059 |
chromosome segregation
|
IMP |
biological process |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0000070 |
mitotic sister chromatid segregation
|
IMP |
biological process |
GO:0000776 |
kinetochore
|
IEA |
cellular component |
GO:0007051 |
spindle organization
|
IEA |
biological process |
GO:0051988 |
regulation of attachment of spindle microtubules t o kinetochore
|
IEA |
biological process |
GO:0007059 |
chromosome segregation
|
IEA |
biological process |
GO:0051301 |
cell division
|
IEA |
biological process |
GO:0000776 |
kinetochore
|
IEA |
cellular component |
GO:0000775 |
chromosome, centromeric r egion
|
IEA |
cellular component |
GO:0005694 |
chromosome
|
IEA |
cellular component |
GO:0005737 |
cytoplasm
|
IEA |
cellular component |
GO:0005634 |
nucleus
|
IEA |
cellular component |
GO:0007049 |
cell cycle
|
IEA |
biological process |
GO:0005856 |
cytoskeleton
|
IEA |
cellular component |
GO:0005874 |
microtubule
|
IEA |
cellular component |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005634 |
nucleus
|
IEA |
cellular component |
GO:0000922 |
spindle pole
|
IEA |
cellular component |
GO:0000777 |
condensed chromosome kine tochore
|
IEA |
cellular component |
GO:0072686 |
mitotic spindle
|
IDA |
cellular component |
GO:0005886 |
plasma membrane
|
IDA |
cellular component |
GO:0034451 |
centriolar satellite
|
IDA |
cellular component |
|
|
| Associated diseases |
References |
| Spermatogenic defects | MIK: 31037746 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 31037746 |
Spermatoge nic defect s
|
|
|
16 (1 control, 15 cases)
|
Male infertility |
GSE6023 analyzed using GEO2R
|
Show abstract |
|