• Gene id: 9040

Gene Summary

• Gene Symbol: UBE2M   Gene   UCSC   Ensembl
• Aliases: UBC-RS2, UBC12, hUbc12
• Gene name: ubiquitin conjugating enzyme E2 M
• Alternate names: NEDD8-conjugating enzyme Ubc12, NEDD8 carrier protein, NEDD8 protein ligase, epididymis secretory sperm binding protein, ubiquitin carrier protein M, ubiquitin conjugating enzyme E2M, ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast), ubiquitin-protein lig,
• Gene location: 19q13.43 (58558610: 58555711)     Exons: 6     NC_000019.10
• Gene summary(Entrez): The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conju
• OMIM: 607409

Protein Summary

• Protein general information: P61081  
  • Name: NEDD8 conjugating enzyme Ubc12 (EC 2.3.2. ) (NEDD8 carrier protein) (Ubiquitin conjugating enzyme E2 M)
  • Length: 183  
  • Mass: 20900
• Sequence:

  MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGK
  FVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAA
  EVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

• Structural information:
  • Interpro: IPR000608  IPR023313  IPR016135  
  • Prosite: PS00183 PS50127
  • CDD: cd00195
  • PDB: 1TT5 1Y8X 2NVU 3TDU 3TDZ 4GAO 4P5O
  • PDBsum: 1TT5 1Y8X 2NVU 3TDU 3TDZ 4GAO 4P5O
  • DIP: 35679
  • STRING: ENSP00000253023
• Other Databases: GeneCards:  UBE2M  Malacards:  UBE2M

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0019788	NEDD8 transferase activity	IBA	molecular function
GO:0045116	protein neddylation	IBA	biological process
GO:0045116	protein neddylation	IDA	biological process
GO:0019788	NEDD8 transferase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019788	NEDD8 transferase activity	TAS	molecular function
GO:0019788	NEDD8 transferase activity	TAS	molecular function
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0045116	protein neddylation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006464	cellular protein modification process	IMP	biological process
GO:0006464	cellular protein modification process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IMP	molecular function
GO:0004842	ubiquitin-protein transferase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881