• Gene id: 90390

Gene Summary

• Gene Symbol: MED30   Gene   UCSC   Ensembl
• Aliases: MED30S, THRAP6, TRAP25
• Gene name: mediator complex subunit 30
• Alternate names: mediator of RNA polymerase II transcription subunit 30, TRAP/Mediator complex component TRAP25, putative mediator of RNA polymerase II transcription subunit 30, thyroid hormone receptor-associated protein 6, thyroid hormone receptor-associated protein complex,
• Gene location: 8q24.11 (117520712: 117540261)     Exons: 5     NC_000008.11
• Gene summary(Entrez): The multiprotein TRAP/Mediator complex facilitates gene expression through a wide variety of transcriptional activators. MED30 is a component of this complex that appears to be metazoan specific (Baek et al., 2002 [PubMed 11909976]).[supplied by OMIM, Nov
• OMIM: 610237

Protein Summary

• Protein general information: Q96HR3  
  • Name: Mediator of RNA polymerase II transcription subunit 30 (Mediator complex subunit 30) (TRAP/Mediator complex component TRAP25) (Thyroid hormone receptor associated protein 6) (Thyroid hormone receptor associated protein complex 25 kDa component) (Trap25)
  • Length: 178  
  • Mass: 20277
  • Tissue specificity: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO
• Sequence:

  MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRL
  TKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLK
  QKNQQLKQIMDQLRNLIWDINAMLAMRN

• Structural information:
  • Interpro: IPR021019  
  • STRING: ENSP00000297347
• Other Databases: GeneCards:  MED30  Malacards:  MED30

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0016592	mediator complex	IBA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IBA	biological process
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016592	mediator complex	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0000151	ubiquitin ligase complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0003712	transcription coregulator activity	IDA	molecular function
GO:0046966	thyroid hormone receptor binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0016592	mediator complex	IDA	cellular component
GO:0030374	nuclear receptor transcription coactivator activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042809	vitamin D receptor binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04919	Thyroid hormone signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)