• Gene id: 90362

Gene Summary

• Gene Symbol: FAM110B   Gene   UCSC   Ensembl
• Aliases: C8orf72
• Gene name: family with sequence similarity 110 member B
• Alternate names: protein FAM110B,
• Gene location: 8q12.1 (57994522: 58148783)     Exons: 7     NC_000008.11

Protein Summary

• Protein general information: Q8TC76  
  • Name: Protein FAM110B
  • Length: 370  
  • Mass: 40728
  • Tissue specificity: Detected in thyroid, spleen and testis, and at lower levels in stomach, spinal cord, lymph node, trachea, adrenal gland, prostate, ovary and intestine. {ECO
• Sequence:

  MPTETLQTGSMVKPVSPAGTFTSAVPLRILNKGPDYFRRQAEPNPKRLSAVERLEADKAKYVKSQEVINAKQEPV
  KPAVLAKPPVCPAAKRALGSPTLKVFGNHAKTESGVQRENLKLEILKNIINSSEGSSSGSGHKHSSRNWPPHRSE
  ATDLHRHSFAESLKVYPTQGRRSPQEGGSHVGRRLLEQSAESFLHVSHSSSDIRKVTSVKPLKAIPCSSSAPPLP
  PKPKIAAIASMKSPEADPVEPACGVSRRPSLQRSKSDLSDRYFRVDADVERFFNYCGLDPEELENLGMENFARAN
  SDIISLNFRSASMISSDCEQSQDSNSDLRNDDSANDRVPYGISAIERNARIIKWLYSIKQARESQKVSHV

• Structural information:
  • Interpro: IPR025740  IPR025741  IPR025739  
  • STRING: ENSP00000355204
• Other Databases: GeneCards:  FAM110B  Malacards:  FAM110B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq