• Gene id: 9034

Gene Summary

• Gene Symbol: CCRL2   Gene   UCSC   Ensembl
• Aliases: ACKR5, CKRX, CRAM, CRAM-A, CRAM-B, HCR
• Gene name: C-C motif chemokine receptor like 2
• Alternate names: C-C chemokine receptor-like 2, atypical chemokine receptor 5, chemokine (C-C motif) receptor-like 2, chemokine receptor CCR11, chemokine receptor X, putative MCP-1 chemokine receptor,
• Gene location: 3p21.31 (46407165: 46409522)     Exons: 5     NC_000003.12
• Gene summary(Entrez): This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune c
• OMIM: 611104

Protein Summary

• Protein general information: O00421  
  • Name: C C chemokine receptor like 2 (Chemokine receptor CCR11) (Chemokine receptor X) (Putative MCP 1 chemokine receptor)
  • Length: 344  
  • Mass: 39513
  • Tissue specificity: Expressed abundantly in immunal tissues such as spleen, fetal liver, lymph node and bone marrow. Strong expression also in lung and heart. Expressed in almost all hematopoietic cells including monocytes, macrophages, PMNs, T-cells (bot
• Sequence:

  MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENI
  YLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGII
  TSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRK
  TLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLY
  AFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

• Structural information:
  • Interpro: IPR000355  IPR000276  IPR017452  
  • Prosite: PS50262
  • STRING: ENSP00000349967
• Other Databases: GeneCards:  CCRL2  Malacards:  CCRL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0048020	CCR chemokine receptor binding	IPI	molecular function
GO:0006954	inflammatory response	ISS	biological process
GO:0042379	chemokine receptor binding	IPI	molecular function
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0019957	C-C chemokine binding	IBA	molecular function
GO:0060326	cell chemotaxis	IBA	biological process
GO:0019956	chemokine binding	IBA	molecular function
GO:0019722	calcium-mediated signaling	IBA	biological process
GO:0016493	C-C chemokine receptor activity	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006935	chemotaxis	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0048020	CCR chemokine receptor binding	IPI	molecular function
GO:0006954	inflammatory response	ISS	biological process
GO:0042379	chemokine receptor binding	IPI	molecular function
GO:0004950	chemokine receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004950	chemokine receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881