• Gene id: 90332

Gene Summary

• Gene Symbol: EXOC3L2   Gene   UCSC   Ensembl
• Aliases: XTP7
• Gene name: exocyst complex component 3 like 2
• Alternate names: exocyst complex component 3-like protein 2, HBV X-transactivated gene 7 protein, HBV XAg-transactivated protein 7, protein 7 transactivated by hepatitis B virus X antigen (HBxAg),
• Gene location: 19q13.32 (45234210: 45212376)     Exons: 10     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is upregulated by vascular endothelial growth factor A and interacts with exocyst complex component 4. The encoded protein may be part of an exocyst complex that plays a role in cell membrane dynamics. Mutations in this ge
• OMIM: 609807

Protein Summary

• Protein general information: Q2M3D2  
  • Name: Exocyst complex component 3 like protein 2 (HBV X transactivated gene 7 protein) (HBV XAg transactivated protein 7)
  • Length: 409  
  • Mass: 45859
• Sequence:

  MAALENGELGPLLSPGTLRGLEDECVTDVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQDVCELLEEHTERAPR
  ISQEFGERMAHCCLGGLAEFLQSFQQRVERFHENPAVREMLPDTYISKTIALVNCGPPLRALAERLARVGPPESE
  PAREASASALDHVTRLCHRVVANLLFQELQPHFNKLMRRKWLSSPEALDGIVGTLGAQALALRRMQDEPYQALVA
  ELHRRALVEYVRPLLRGRLRCSSARTRSRVAGRLREDAAQLQRLFRRLESQASWLDAVVPHLAEVMQLEDTPSIQ
  VEVGVLVRDYPDIRQKHVAALLDIRGLRNTAARQEILAVARDLELSEEGALSPPRDRAFFADIPVPRPSFCLSLP
  LFLGRLPLSRLARPSLACLPRPRPPSLARPRAQR

• Structural information:
  • Interpro: IPR010326  
  • STRING: ENSP00000400713
• Other Databases: GeneCards:  EXOC3L2  Malacards:  EXOC3L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000145	exocyst	IBA	cellular component
GO:0000149	SNARE binding	IBA	molecular function
GO:0006887	exocytosis	IBA	biological process
GO:0051601	exocyst localization	IBA	biological process
GO:0000145	exocyst	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq