• Gene id: 90316

Gene Summary

• Gene Symbol: TGIF2LX   Gene   UCSC   Ensembl
• Aliases: TGIFLX
• Gene name: TGFB induced factor homeobox 2 like, X-linked
• Alternate names: homeobox protein TGIF2LX, TGF-beta-induced transcription factor 2-like protein, TGFB-induced factor 2-like protein, X-linked, TGFB-induced factor 2-like, X-linked, TGIF-like on the X,
• Gene location: Xq21.31 (89921940: 89922882)     Exons: 2     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests that this gene may play a role in spermatogenesis. A homolog of this gene lies within the male specific region of chromosome Y, in a
• OMIM: 300411

Protein Summary

• Protein general information: Q8IUE1  
  • Name: Homeobox protein TGIF2LX (TGF beta induced transcription factor 2 like protein) (TGFB induced factor 2 like protein, X linked) (TGIF like on the X)
  • Length: 241  
  • Mass: 26,675
• Sequence:

  MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFK
  AYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSG
  PDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAV
  QRAAELELEKKQEPNP

• Structural information:
  • Interpro: IPR009057  IPR001356  IPR008422  
  • Prosite: PS50071
  • CDD: cd00086
  • PDB: 2DMN
  • PDBsum: 2DMN
  • STRING: ENSP00000355119
• Other Databases: GeneCards:  TGIF2LX  Malacards:  TGIF2LX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process

Diseases

Associated diseases	References
Azoospermia	MIK: 18384077
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 18384077
Male infertility	MIK: 18384077
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18384077	Azoospermia, male infertility			110 with nonobstructive azoospermia	Male infertility	TGIFLX TGIFLY
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881