• Gene id: 90226

Gene Summary

• Gene Symbol: UCN2   Gene   UCSC   Ensembl
• Aliases: SRP, UCN-II, UCNI, UR, URP
• Gene name: urocortin 2
• Alternate names: urocortin-2, prepro-urocortin 2, stresscopin-related peptide, ucn II, urocortin II, urocortin-related peptide,
• Gene location: 3p21.31 (48563780: 48561717)     Exons: 2     NC_000003.12
• Gene summary(Entrez): This gene is a member of the sauvagine/corticotropin-releasing factor/urotensin I family. It is structurally related to the corticotropin-releasing factor (CRF) gene and the encoded product is an endogenous ligand for CRF type 2 receptors. In the brain it
• OMIM: 103870

Protein Summary

• Protein general information: Q96RP3  
  • Name: Urocortin 2 (Stresscopin related peptide) (Urocortin II) (Ucn II) (Urocortin related peptide)
  • Length: 112  
  • Mass: 12146
• Sequence:

  MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLS
  LDVPIGLLQILLEQARARAAREQATTNARILARVGHC

• Structural information:
  • Interpro: IPR000187  IPR024273  IPR024270  
  • PDB: 2RMG 3N95
  • PDBsum: 2RMG 3N95
  • STRING: ENSP00000273610
• Other Databases: GeneCards:  UCN2  Malacards:  UCN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0051429	corticotropin-releasing hormone receptor binding	IBA	molecular function
GO:0031669	cellular response to nutrient levels	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0051431	corticotropin-releasing hormone receptor 2 binding	IEA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0007586	digestion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0001664	G protein-coupled receptor binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0009755	hormone-mediated signaling pathway	IDA	biological process
GO:0042562	hormone binding	IPI	molecular function
GO:0007586	digestion	NAS	biological process
GO:0051429	corticotropin-releasing hormone receptor binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Hypertension	PMID:19204182
Atherosclerosis	PMID:16026900
congestive heart failure	PMID:12076554
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq