• Gene id: 9021

Gene Summary

• Gene Symbol: SOCS3   Gene   UCSC   Ensembl
• Aliases: ATOD4, CIS3, Cish3, SOCS-3, SSI-3, SSI3
• Gene name: suppressor of cytokine signaling 3
• Alternate names: suppressor of cytokine signaling 3, STAT-induced STAT inhibitor 3, cytokine-inducible SH2 protein 3,
• Gene location: 17q25.3 (78360078: 78356776)     Exons: 2     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced
• OMIM: 123840

Protein Summary

• Protein general information: O14543  
  • Name: Suppressor of cytokine signaling 3 (SOCS 3) (Cytokine inducible SH2 protein 3) (CIS 3) (STAT induced STAT inhibitor 3) (SSI 3)
  • Length: 225  
  • Mass: 24770
  • Tissue specificity: Widely expressed with high expression in heart, placenta, skeletal muscle, peripheral blood leukocytes, fetal and adult lung, and fetal liver and kidney. Lower levels in thymus.
• Sequence:

  MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSD
  QRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQ
  PSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

• Structural information:
  • Protein Domains: (46..14-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (177..22-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR000980  IPR036860  IPR028414  IPR035863  IPR001496   IPR036036  
  • Prosite: PS50001 PS50225
  • CDD: cd10384
  • STRING: ENSP00000330341
• Other Databases: GeneCards:  SOCS3  Malacards:  SOCS3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0004860	protein kinase inhibitor activity	TAS	molecular function
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	TAS	biological process
GO:0060334	regulation of interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0070102	interleukin-6-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0045597	positive regulation of cell differentiation	IEA	biological process
GO:0060674	placenta blood vessel development	IEA	biological process
GO:0001784	phosphotyrosine residue binding	IEA	molecular function
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0045595	regulation of cell differentiation	IEA	biological process
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0060670	branching involved in labyrinthine layer morphogenesis	IEA	biological process
GO:0060707	trophoblast giant cell differentiation	IEA	biological process
GO:0060708	spongiotrophoblast differentiation	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0046426	negative regulation of receptor signaling pathway via JAK-STAT	IMP	biological process
GO:0042532	negative regulation of tyrosine phosphorylation of STAT protein	IMP	biological process
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa04120	Ubiquitin mediated proteolysis
hsa04932	Non-alcoholic fatty liver disease
hsa04630	JAK-STAT signaling pathway
hsa05164	Influenza A
hsa04910	Insulin signaling pathway
hsa04380	Osteoclast differentiation
hsa05160	Hepatitis C
hsa04935	Growth hormone synthesis, secretion and action
hsa04668	TNF signaling pathway
hsa04931	Insulin resistance
hsa04920	Adipocytokine signaling pathway
hsa04917	Prolactin signaling pathway
hsa04930	Type II diabetes mellitus

Diseases

Associated diseases	References
Ductal carcinoma in situ	PMID:12888825
invasive ductal carcinoma	PMID:12888825
type 2 diabetes mellitus	PMID:15331532
obesity	PMID:16920065
obesity	PMID:15331532
Hypospadias	MIK: 24778562
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray