• Gene id: 90203

Gene Summary

• Gene Symbol: SNX21   Gene   UCSC   Ensembl
• Aliases: C20orf161, PP3993, SNX-L, dJ337O18.4
• Gene name: sorting nexin family member 21
• Alternate names: sorting nexin-21, sorting nexin L,
• Gene location: 20q13.12 (42746102: 42744497)     Exons: 1     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like

Protein Summary

• Protein general information: Q969T3  
  • Name: Sorting nexin 21 (Sorting nexin L) (SNX L)
  • Length: 373  
  • Mass: 41365
  • Tissue specificity: Highly expressed in fetus liver, but only weakly expressed in brain, skeleton muscle, smooth muscle, and cardiac muscle, kidney, and adrenal gland. {ECO
• Sequence:

  MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDEDDEDE
  DDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANVVKDPPSKYVL
  YTLAVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPRKRLRRNFTAETIARRSRAFEQFLGHLQA
  VPELRHAPDLQDFFVLPELRRAQSLTCTGLYREALALWANAWQLQAQLGTPSGPDRPLLTLAGLAVCHQELEDPG
  EARACCEKALQLLGDKSLHPLLAPFLEAHVRLSWRLGLDKRQSEARLQALQEAGLTPTPPPSLKELLIKEVLD

• Structural information:
  • Protein Domains: (129..24-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147"-)
  • Interpro: IPR001683  IPR036871  IPR039937  IPR011990  
  • Prosite: PS50195
  • STRING: ENSP00000418593
• Other Databases: GeneCards:  SNX21  Malacards:  SNX21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031901	early endosome membrane	ISS	cellular component
GO:0032266	phosphatidylinositol-3-phosphate binding	ISS	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	ISS	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0032266	phosphatidylinositol-3-phosphate binding	IEA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)