• Gene id: 90199

Gene Summary

• Gene Symbol: WFDC8   Gene   UCSC   Ensembl
• Aliases: C20orf170, HEL-S-292, WAP8, dJ461P17.1
• Gene name: WAP four-disulfide core domain 8
• Alternate names: WAP four-disulfide core domain protein 8, WAP motif protein 1, epididymis secretory protein Li 292, epididymis secretory sperm binding protein, protease inhibitor WAP8, putative protease inhibitor WAP8, testicular secretory protein Li 68,
• Gene location: 20q13.12 (45579304: 45551151)     Exons: 7     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The enco

Protein Summary

• Protein general information: Q8IUA0  
  • Name: WAP four disulfide core domain protein 8 (Putative protease inhibitor WAP8)
  • Length: 241  
  • Mass: 27824
  • Tissue specificity: Expressed ubiquitously, the highest levels are found in the epididymis followed by testis and trachea.
• Sequence:

  MWTVRTEGGHFPLHSPTFSWRNVAFLLLLSLALEWTSAMLTKKIKHKPGLCPKERLTCTTELPDSCNTDFDCKEY
  QKCCFFACQKKCMDPFQEPCMLPVRHGNCNHEAQRWHFDFKNYRCTPFKYRGCEGNANNFLNEDACRTACMLIVK
  DGQCPLFPFTERKECPPSCHSDIDCPQTDKCCESRCGFVCARAWTVKKGFCPRKPLLCTKIDKPKCLQDEECPLV
  EKCCSHCGLKCMDPRR

• Structural information:
  • Protein Domains: (44..9-)
    (/note="WAP-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722-)
    (95..14-)
    (/note="BPTI/Kunitz-inhibitor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00031-)
    (147..19-)
    (/note="WAP-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:P-)
  • Interpro: IPR036645  IPR002223  IPR036880  IPR020901  IPR008197   IPR042931  
  • Prosite: PS00280 PS50279 PS51390
  • CDD: cd00109
  • STRING: ENSP00000361735
• Other Databases: GeneCards:  WFDC8  Malacards:  WFDC8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq