• Gene id: 90161

Gene Summary

• Gene Symbol: HS6ST2   Gene   UCSC   Ensembl
• Aliases: MRXSPM
• Gene name: heparan sulfate 6-O-sulfotransferase 2
• Alternate names: heparan-sulfate 6-O-sulfotransferase 2, HS6ST-2,
• Gene location: Xq26.2 (132961369: 132626011)     Exons: 11     NC_000023.11
• Gene summary(Entrez): Heparan sulfate proteoglycans are ubiquitous components of the cell surface, extracellular matrix, and basement membranes, and interact with various ligands to influence cell growth, differentiation, adhesion, and migration. This gene encodes a member of
• OMIM: 606356

Protein Summary

• Protein general information: Q96MM7  
  • Name: Heparan sulfate 6 O sulfotransferase 2 (HS6ST 2) (EC 2.8.2. )
  • Length: 605  
  • Mass: 69130
• Sequence:

  MALPACAVREFEPPRQPERGAPVRTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSHGFHTRPLLDKPRKAS
  SSLAGAACAPLFALLSRGRRRRMHVLRRRWDLGSLCRALLTRGLAALGHSLKHVLGAIFSKIFGPMASVGNMDEK
  SNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESSARFVPRYNFTRGDLLRKVDFDIKG
  DDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCV
  PSVVDGKRDARLRPSRNFHYITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPL
  KEFMDCPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKTQYLFEKTFNM
  NFISPFTQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLFLQRYQFMRQKEHQEARRKRQEQRKFLKGRL
  LQTHFQSQGQGQSQNPNQNQSQNPNPNANQNLTQNLMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTNDYIGS
  VEKWR

• Structural information:
  • Interpro: IPR010635  IPR027417  IPR005331  
  • STRING: ENSP00000429473
• Other Databases: GeneCards:  HS6ST2  Malacards:  HS6ST2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017095	heparan sulfate 6-O-sulfotransferase activity	IBA	molecular function
GO:0015015	heparan sulfate proteoglycan biosynthetic process, enzymatic modification	IBA	biological process
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R