• Gene id: 9016

Gene Summary

• Gene Symbol: SLC25A14   Gene   UCSC   Ensembl
• Aliases: BMCP1, UCP5
• Gene name: solute carrier family 25 member 14
• Alternate names: brain mitochondrial carrier protein 1, mitochondrial uncoupling protein 5,
• Gene location: Xq26.1 (130339887: 130373360)     Exons: 13     NC_000023.11
• Gene summary(Entrez): Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). Uncoupling proteins separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mito
• OMIM: 300242

Protein Summary

• Protein general information: O95258  
  • Name: Brain mitochondrial carrier protein 1 (BMCP 1) (Mitochondrial uncoupling protein 5) (UCP 5) (Solute carrier family 25 member 14)
  • Length: 325  
  • Mass: 36202
  • Tissue specificity: Mainly expressed in brain. Some expression in testis and pituitary. {ECO
• Sequence:

  MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSI
  DARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVV
  SGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHL
  ILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFW
  PNWLRLGPWNIIFFITYEQLKRLQI

• Structural information:
  • Interpro: IPR002030  IPR018108  IPR023395  IPR032933  
  • Prosite: PS50920
  • STRING: ENSP00000477981
• Other Databases: GeneCards:  SLC25A14  Malacards:  SLC25A14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006839	mitochondrial transport	IEA	biological process
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0009060	aerobic respiration	TAS	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:1902600	proton transmembrane transport	TAS	biological process
GO:1902600	proton transmembrane transport	TAS	biological process
GO:0005740	mitochondrial envelope	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)