• Gene id: 9013

Gene Summary

• Gene Symbol: TAF1C   Gene   UCSC   Ensembl
• Aliases: MGC:39976, SL1, TAFI110, TAFI95
• Gene name: TATA-box binding protein associated factor, RNA polymerase I subunit C
• Alternate names: TATA box-binding protein-associated factor RNA polymerase I subunit C, RNA polymerase I-specific TBP-associated factor 110 kDa, SL1, 110kD subunit, TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD, TATA box binding protein (TBP)-as,
• Gene location: 16q24.1 (84187069: 84177846)     Exons: 17     NC_000016.10
• Gene summary(Entrez): Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of
• OMIM: 604905

Protein Summary

• Protein general information: Q15572  
  • Name: TATA box binding protein associated factor RNA polymerase I subunit C (RNA polymerase I specific TBP associated factor 110 kDa) (TAFI110) (TATA box binding protein associated factor 1C) (TBP associated factor 1C) (Transcription initiation factor SL1/TIF I
  • Length: 869  
  • Mass: 95213
• Sequence:

  MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGALHVTKDLLWEPATPGPLPMLPPLIDP
  WDPGLTARDLLFRGGCRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTKKKTVVSVKKL
  LQDLGGHQPWGCPWAYLSNRQRRFSILGGPILGTSVASHLAELLHEELVLRWEQLLLDEACTGGALAWVPGRTPQ
  FGQLVYPAGGAQDRLHFQEVVLTPGDNPQFLGKPGRIQLQGPVRQVVTCTVQGESKALIYTFLPHWLTCYLTPGP
  FHPSSALLAVRSDYHCAVWKFGKQWQPTLLQAMQVEKGATGISLSPHLPGELAICSRSGAVCLWSPEDGLRQIYR
  DPETLVFRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPK
  CLPPTLHLVCTQFSLYLVDERLPLVPMLKWNHGLPSPLLLARLLPPPRPSCVQPLLLGGQGGQLQLLHLAGEGAS
  VPRLAGPPQSLPSRIDSLPAFPLLEPKIQWRLQERLKAPTIGLAAVVPPLPSAPTPGLVLFQLSAAGDVFYQQLR
  PQVDSSLRRDAGPPGDTQPDCHAPTASWTSQDTAGCSQWLKALLKVPLAPPVWTAPTFTHRQMLGSTELRREEEE
  GQRLGVLRKAMARGQLLLQRDLGSLPAAEPPPAPESGLEDKLSERLGEAWAGRGAAWWERQQGRTSEPGRQTRRP
  KRRTQLSSSFSLSGHVDPSEDTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQ
  RDTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPRMGF

• Structural information:
  • Interpro: IPR038801  IPR015943  IPR036322  
  • DIP: 269
  • STRING: ENSP00000455265
• Other Databases: GeneCards:  TAF1C  Malacards:  TAF1C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001181	RNA polymerase I general transcription initiation factor activity	IDA	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0006361	transcription initiation from RNA polymerase I promoter	NAS	biological process
GO:0001164	RNA polymerase I core promoter sequence-specific DNA binding	IBA	molecular function
GO:0001650	fibrillar center	IBA	cellular component
GO:0006360	transcription by RNA polymerase I	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006360	transcription by RNA polymerase I	TAS	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006361	transcription initiation from RNA polymerase I promoter	TAS	biological process
GO:0006361	transcription initiation from RNA polymerase I promoter	TAS	biological process
GO:0006362	transcription elongation from RNA polymerase I promoter	TAS	biological process
GO:0006363	termination of RNA polymerase I transcription	TAS	biological process
GO:0045815	positive regulation of gene expression, epigenetic	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0001188	RNA polymerase I preinitiation complex assembly	IEA	biological process
GO:0001188	RNA polymerase I preinitiation complex assembly	IEA	biological process
GO:0001164	RNA polymerase I core promoter sequence-specific DNA binding	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881