• Gene id: 90120

Gene Summary

• Gene Symbol: TMEM250   Gene   UCSC   Ensembl
• Aliases: C9orf69
• Gene name: transmembrane protein 250
• Alternate names: transmembrane protein 250, herpes virus UL25-binding protein, protein C9orf69,
• Gene location: 9q34.3 (136118874: 136114580)     Exons: 3     NC_000009.12
• OMIM: 607869

Protein Summary

• Protein general information: H0YL14  
  • Name: Transmembrane protein 250 (Herpes virus UL25 binding protein)
  • Length: 139  
  • Mass: 16083
• Sequence:

  MPVMPIPRRVRSFHGPHTTCLHAACGPVRASHLARTKYNNFDVYIKTRWLYGFIRFLLYFSCSLFTAALWGALAA
  LFCLQYLGVRVLLRFQRKLSVLLLLLGRRRVDFRLVNELLVYGIHVTMLLVGGLGWCFMVFVDM

• Structural information:
  • Interpro: IPR041156  
• Other Databases: GeneCards:  TMEM250  Malacards:  TMEM250

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061640	cytoskeleton-dependent cytokinesis	IBA	biological process
GO:0032153	cell division site	IBA	cellular component
GO:0015630	microtubule cytoskeleton	IBA	cellular component
GO:0005940	septin ring	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0060090	molecular adaptor activity	IBA	molecular function
GO:0034613	cellular protein localization	IBA	biological process
GO:0031105	septin complex	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0048524	positive regulation of viral process	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq