• Gene id: 901

Gene Summary

• Gene Symbol: CCNG2   Gene   UCSC   Ensembl
• Gene name: cyclin G2
• Alternate names: cyclin-G2,
• Gene location: 4q21.1 (77157206: 77170059)     Exons: 10     NC_000004.12
• Gene summary(Entrez): The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The 8 species of cyclins reported in mammals, cyclins A through H, share a conserved amino acid sequence of abou
• OMIM: 314980

Protein Summary

• Protein general information: Q16589  
  • Name: Cyclin G2
  • Length: 344  
  • Mass: 38866
  • Tissue specificity: High levels in cerebellum, thymus, spleen and prostate. Low levels in skeletal muscle.
• Sequence:

  MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFFGSCTE
  TFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKRMEKIISEKLH
  YELEATTALNFLHLYHTIILCHTSERKEILSLDKLEAQLKACNCRLIFSKAKPSVLALCLLNLEVETLKSVELLE
  ILLLVKKHSKINDTEFFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFD
  ESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS

• Structural information:
  • Interpro: IPR028895  IPR039361  IPR013763  IPR036915  IPR006671  
  • CDD: cd00043
  • STRING: ENSP00000315743
• Other Databases: GeneCards:  CCNG2  Malacards:  CCNG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044772	mitotic cell cycle phase transition	IBA	biological process
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IBA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04068	FoxO signaling pathway
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881