• Gene id: 90025

Gene Summary

• Gene Symbol: UBE3D   Gene   UCSC   Ensembl
• Aliases: C6orf157, H10BH, UBE2CBP, YJR141W
• Gene name: ubiquitin protein ligase E3D
• Alternate names: E3 ubiquitin-protein ligase E3D, HECT-type E3 ubiquitin transferase E3D, UBCH10 binding protein with a hect-like domain, ubcH10-binding protein with a HECT-like domain, ubiquitin-conjugating enzyme E2C-binding protein,
• Gene location: 6q14.1 (83065840: 82880833)     Exons: 22     NC_000006.12

Protein Summary

• Protein general information: Q7Z6J8  
  • Name: E3 ubiquitin protein ligase E3D (EC 2.3.2.26) (HECT type E3 ubiquitin transferase E3D) (UbcH10 binding protein with a HECT like domain) (Ubiquitin conjugating enzyme E2C binding protein)
  • Length: 389  
  • Mass: 43657
• Sequence:

  MAASAAETRVFLEVRGQLQSALLILGEPKEGGMPMNISIMPSSLQMKTPEGCTEIQLPAEVRLVPSSCRGLQFVV
  GDGLHLRLQTQAKLGTKLISMFNQSSQTQECCTFYCQSCGEVIIKDRKLLRVLPLPSENWGALVGEWCCHPDPFA
  NKSLHPQENDCFIGDSFFLVNLRTSLWQQRPELSPVEMCCVSSDNHCKLEPKANTKVICKRCKVMLGETVSSETT
  KFYMTEIIIQSSERSFPIIPRSWFVQSVIAQCLVQLSSARSTFRFTIQGQDDKVYILLWLLNSDSLVIESLRNSK
  YIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHPLTLPSATCLELLLILSKSNANLPSS
  LRRVNSFQVAFLKM

• Structural information:
  • Interpro: IPR019193  
  • STRING: ENSP00000358762
• Other Databases: GeneCards:  UBE3D  Malacards:  UBE3D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0000151	ubiquitin ligase complex	IBA	cellular component
GO:0051865	protein autoubiquitination	IBA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0030332	cyclin binding	IBA	molecular function
GO:0006513	protein monoubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0006513	protein monoubiquitination	IDA	biological process
GO:0051865	protein autoubiquitination	IDA	biological process
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0030332	cyclin binding	IPI	molecular function
GO:0044390	ubiquitin-like protein conjugating enzyme binding	IPI	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray