• Gene id: 90007

Gene Summary

• Gene Symbol: MIDN   Gene   UCSC   Ensembl
• Gene name: midnolin
• Alternate names: midnolin, midbrain nucleolar protein,
• Gene location: 19p13.3 (22003762: 21756547)     Exons: 14     NC_000010.11
• OMIM: 606700

Protein Summary

• Protein general information: Q504T8  
  • Name: Midnolin (Midbrain nucleolar protein)
  • Length: 468  
  • Mass: 49213
• Sequence:

  MEPQPGGARSCRRGAPGGACELGPAAEAAPMSLAIHSTTGTRYDLAVPPDETVEGLRKRLSQRLKVPKERLALLH
  KDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMM
  FVQLQLAAQHAPLQHRHVLAAAAAAAAARGDPSIASPVSSPCRPVSSAARVPPVPTSPSPASPSPITAGSFRSHA
  ASTTCPEQMDCSPTASSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPR
  RDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKP
  PGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSPSRKAGRSDSSSSGGGGSPSEASGLGLDFED
  SVWKPEVNPDIKSEFVVA

• Structural information:
  • Protein Domains: (31..10-)
    (/note="Ubiquitin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00214"-)
  • Interpro: IPR039336  IPR000626  IPR029071  
  • Prosite: PS50053
  • STRING: ENSP00000300952
• Other Databases: GeneCards:  MIDN  Malacards:  MIDN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033132	negative regulation of glucokinase activity	IEA	biological process
GO:0046676	negative regulation of insulin secretion	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0019900	kinase binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0046676	negative regulation of insulin secretion	ISS	biological process
GO:0033132	negative regulation of glucokinase activity	ISS	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0019900	kinase binding	ISS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq