• Gene id: 8996

Gene Summary

• Gene Symbol: NOL3   Gene   UCSC   Ensembl
• Aliases: ARC, FCM, MYOCL1, MYP, NOP, NOP30
• Gene name: nucleolar protein 3
• Alternate names: nucleolar protein 3, muscle-enriched cytoplasmic protein, nucleolar protein 3 (apoptosis repressor with CARD domain), nucleolar protein of 30 kDa,
• Gene location: 16q22.1 (67170496: 67175736)     Exons: 6     NC_000016.10
• Gene summary(Entrez): This gene encodes an anti-apoptotic protein that has been shown to down-regulate the enzyme activities of caspase 2, caspase 8 and tumor protein p53. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefS
• OMIM: 617902

Protein Summary

• Protein general information: O60936  
  • Name: Nucleolar protein 3 (Apoptosis repressor with CARD) (Muscle enriched cytoplasmic protein) (Myp) (Nucleolar protein of 30 kDa) (Nop30)
  • Length: 208  
  • Mass: 22629
  • Tissue specificity: Highly expressed in heart and skeletal muscle. Detected at low levels in placenta, liver, kidney and pancreas.
• Sequence:

  MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQE
  LLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTP
  EEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

• Structural information:
  • Protein Domains: (4..9-)
    (/note="CARD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00046"-)
  • Interpro: IPR001315  IPR011029  
  • Prosite: PS50209
  • PDB: 4UZ0
  • PDBsum: 4UZ0
  • DIP: 29940
  • STRING: ENSP00000457243
• Other Databases: GeneCards:  NOL3  Malacards:  NOL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006376	mRNA splice site selection	IDA	biological process
GO:0051259	protein complex oligomerization	IDA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0043027	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IDA	molecular function
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:1990001	inhibition of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:1902176	negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:0014808	release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	biological process
GO:0089720	caspase binding	IPI	molecular function
GO:0089720	caspase binding	IPI	molecular function
GO:0089720	caspase binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0005509	calcium ion binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903298	negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	ISS	biological process
GO:0005739	mitochondrion	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0008380	RNA splicing	TAS	biological process
GO:0005730	nucleolus	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881