• Gene id: 89958

Gene Summary

• Gene Symbol: SAPCD2   Gene   UCSC   Ensembl
• Aliases: C9orf140, p42.3
• Gene name: suppressor APC domain containing 2
• Alternate names: suppressor APC domain-containing protein 2, 2010317E24Rik, TS/MDEP, protein C9orf140, tumor specificity and mitosis phase-dependent expression protein,
• Gene location: 9q34.3 (137070558: 137062126)     Exons: 7     NC_000009.12

Protein Summary

• Protein general information: Q86UD0  
  • Name: Suppressor APC domain containing protein 2 (Tumor specificity and mitosis phase dependent expression protein) (TS/MDEP) (p42.3)
  • Length: 394  
  • Mass: 42637
  • Tissue specificity: Expressed in 5-month-old fetal tissues, including stomach, intestine, colon, liver, brain, lung, heart, spleen and kidney (PubMed
• Sequence:

  MAGAAMAERGRVPPPAPAPSTEGLPRAFLQSLRTLFDILDDRRRGCVHLREIESRWQGTDARELPRGVLEGLRQV
  APASGYLTFERFVAGLRTSLLSADGGPRDPTRAPARPGDQPPPPPQRLVFAPADEPRTVLERKPLPLGVRAPLAG
  PSAAARSPEQLCAPAEAAPCPAEPERSQSAALEPSSSADAGAVACRALEADSGDARRAPRARGERRRHTIASGVD
  CGLLKQMKELEQEKEVLLQGLEMMARGRDWYQQQLQRVQERQRRLGQSRASADFGAAGSPRPLGRLLPKVQEVAR
  CLGELLAAACASRALPPSSSGPPCPALTSTSPPVWQQQTILMLKEQNRLLTQEVTEKSERITQLEQEKSALIKQL
  FEARALSQQDGGPLDSTFI

• Structural information:
  • Interpro: IPR026828  
  • STRING: ENSP00000386348
• Other Databases: GeneCards:  SAPCD2  Malacards:  SAPCD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043296	apical junction complex	IDA	cellular component
GO:0045179	apical cortex	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0000132	establishment of mitotic spindle orientation	ISS	biological process
GO:1904777	negative regulation of protein localization to cell cortex	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098725	symmetric cell division	ISS	biological process
GO:0090175	regulation of establishment of planar polarity	ISS	biological process
GO:0051301	cell division	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000132	establishment of mitotic spindle orientation	IEA	biological process
GO:0098725	symmetric cell division	IEA	biological process
GO:0090175	regulation of establishment of planar polarity	IEA	biological process
GO:0045179	apical cortex	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq