• Gene id: 8994

Gene Summary

• Gene Symbol: LIMD1   Gene   UCSC   Ensembl
• Gene name: LIM domains containing 1
• Alternate names: LIM domain-containing protein 1,
• Gene location: 3p21.31 (45594104: 45686340)     Exons: 9     NC_000003.12
• OMIM: 600026

Protein Summary

• Protein general information: Q9UGP4  
  • Name: LIM domain containing protein 1
  • Length: 676  
  • Mass: 72190
  • Tissue specificity: Expressed in normal and breast cancer tissues (at protein level). Ubiquitous. {ECO
• Sequence:

  MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQQQQLLQEETLPRGSR
  GPVNGGGRLGPQARWEVVGSKLTVDGAAKPPLAASTGAPGAVTTLAAGQPPYPPQEQRSRPYLHGTRHGSQDCGS
  RESLATSEMSAFHQPGPCEDPSCLTHGDYYDNLSLASPKWGDKPGVSPSIGLSVGSGWPSSPGSDPPLPKPCGDH
  PLNHRQLSLSSSRSSEGSLGGQNSGIGGRSSEKPTGLWSTASSQRVSPGLPSPNLENGAPAVGPVQPRTPSVSAP
  LALSCPRQGGLPRSNSGLGGEVSGVMSKPNVDPQPWFQDGPKSYLSSSAPSSSPAGLDGSQQGAVPGLGPKPGCT
  DLGTGPKLSPTSLVHPVMSTLPELSCKEGPLGWSSDGSLGSVLLDSPSSPRVRLPCQPLVPGPELRPSAAELKLE
  ALTQRLEREMDAHPKADYFGACVKCSKGVFGAGQACQAMGNLYHDTCFTCAACSRKLRGKAFYFVNGKVFCEEDF
  LYSGFQQSADRCFLCGHLIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAAC
  GLPILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEKRPSSTALHQHH
  F

• Structural information:
  • Protein Domains: (470..53-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (535..59-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (595..66-)
    3 (/note="LIM-zinc-binding)
    (/evidence="ECO-)
  • Interpro: IPR028734  IPR001781  
  • Prosite: PS00478 PS50023
  • STRING: ENSP00000273317
• Other Databases: GeneCards:  LIMD1  Malacards:  LIMD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000932	P-body	IBA	cellular component
GO:0001666	response to hypoxia	IBA	biological process
GO:0005911	cell-cell junction	IBA	cellular component
GO:0005912	adherens junction	IBA	cellular component
GO:0007010	cytoskeleton organization	IBA	biological process
GO:2000637	positive regulation of gene silencing by miRNA	IBA	biological process
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0035331	negative regulation of hippo signaling	IBA	biological process
GO:0005912	adherens junction	IDA	cellular component
GO:0001666	response to hypoxia	IDA	biological process
GO:0035331	negative regulation of hippo signaling	IDA	biological process
GO:0016310	phosphorylation	IDA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:2000637	positive regulation of gene silencing by miRNA	IMP	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:0007010	cytoskeleton organization	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0045668	negative regulation of osteoblast differentiation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003714	transcription corepressor activity	ISS	molecular function
GO:0002076	osteoblast development	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000932	P-body	IDA	cellular component
GO:0016442	RISC complex	IDA	cellular component
GO:0035195	gene silencing by miRNA	IMP	biological process
GO:0033962	cytoplasmic mRNA processing body assembly	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061418	regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0045668	negative regulation of osteoblast differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0002076	osteoblast development	IEA	biological process
GO:0000932	P-body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04390	Hippo signaling pathway
hsa04392	Hippo signaling pathway - multiple species

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq