• Gene id: 89927

Gene Summary

• Gene Symbol: BMERB1   Gene   UCSC   Ensembl
• Aliases: C16orf45, MINP
• Gene name: bMERB domain containing 1
• Alternate names: bMERB domain-containing protein 1, migration inhibitory protein, uncharacterized protein C16orf45,
• Gene location: 16p13.11 (15434587: 15588258)     Exons: 7     NC_000016.10
• OMIM: 0

Protein Summary

• Protein general information: Q96MC5  
  • Name: bMERB domain containing protein 1
  • Length: 204  
  • Mass: 23732
• Sequence:

  MELKQSLSTHLEAEKPLRRYGAVEETAWKTERLGRNQLDIISMAETTMMPEEIELEMAKIQRLREVLVRRESELR
  FMMDDIQLCKDIMDLKQELQNLVAIPEKEKTKLQKQREDELIQKIHKLVQKRDFLVDDAEVERLREQEEDKEMAD
  FLRIKLKPLDKVTKSPASSRAEKKAEPPPSKPTVAKTGLALIKDCCGATQCNIM

• Structural information:
  • Protein Domains: (3..15-)
    (/note="bMERB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01195"-)
  • Interpro: IPR022735  IPR040127  
  • Prosite: PS51848
  • STRING: ENSP00000300006
• Other Databases: GeneCards:  BMERB1  Malacards:  BMERB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007026	negative regulation of microtubule depolymerization	IEA	biological process
GO:0021822	negative regulation of cell motility involved in cerebral cortex radial glia guided migration	IEA	biological process
GO:0015630	microtubule cytoskeleton	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq