• Gene id: 8991

Gene Summary

• Gene Symbol: SELENBP1   Gene   UCSC   Ensembl
• Aliases: EHMTO, HEL-S-134P, LPSB, MTO, SBP56, SP56, hSBP
• Gene name: selenium binding protein 1
• Alternate names: methanethiol oxidase, 56 kDa selenium-binding protein, epididymis secretory sperm binding protein Li 134P,
• Gene location: 1q21.3 (151372724: 151364303)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. The effects of selenium in preventing

Protein Summary

• Protein general information: Q13228  
  • Name: Methanethiol oxidase (MTO) (EC 1.8.3.4) (56 kDa selenium binding protein) (SBP56) (SP56) (Selenium binding protein 1)
  • Length: 472  
  • Mass: 52391
  • Tissue specificity: Widely expressed. Highly expressed in liver, lung, colon, prostate, kidney and pancreas. In brain, present both in neurons and glia (at protein level). Down-regulated in lung adenocarcinoma, colorectal carcinoma and ovarian cancer. Two
• Sequence:

  MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVIHRLPMPNLKDELHHS
  GWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHKVIEPKDIHAKCELAFLHTSHCLASGEVMIS
  SLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADVEAGLYG
  SHLYVWDWQRHEIVQTLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKG
  WLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGGSIVKGGPVQVLEDEELKSQPEP
  LVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEP
  LGPALAHELRYPGGDCSSDIWI

• Structural information:
  • Interpro: IPR008826  
  • STRING: ENSP00000397261
• Other Databases: GeneCards:  SELENBP1  Malacards:  SELENBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008430	selenium binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0008430	selenium binding	TAS	molecular function
GO:0018549	methanethiol oxidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00920	Sulfur metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq