• Gene id: 899

Gene Summary

• Gene Symbol: CCNF   Gene   UCSC   Ensembl
• Aliases: FBX1, FBXO1
• Gene name: cyclin F
• Alternate names: cyclin-F, F-box only protein 1, G2/mitotic-specific cyclin-F,
• Gene location: 16p13.3 (2429446: 2458853)     Exons: 17     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the cyclin family. Cyclins are important regulators of cell cycle transitions through their ability to bind and activate cyclin-dependent protein kinases. This member also belongs to the F-box protein family which is characte
• OMIM: 167040

Protein Summary

• Protein general information: P41002  
  • Name: Cyclin F (F box only protein 1)
  • Length: 786  
  • Mass: 87640
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MGSGGVVHCRCAKCFCYPTKRRIRRRPRNLTILSLPEDVLFHILKWLSVEDILAVRAVHSQLKDLVDNHASVWAC
  ASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSDEARAEVNGLKASRFFSLAERLNVGAAPFIW
  LFIRPPWSVSGSCCKAVVHESLRAECQLQRTHKASILHCLGRVLSLFEDEEKQQQAHDLFEEAAHQGCLTSSYLL
  WESDRRTDVSDPGRCLHSFRKLRDYAAKGCWEAQLSLAKACANANQLGLEVRASSEIVCQLFQASQAVSKQQVFS
  VQKGLNDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRYRLQLLGIACMVICTRFISKEILTIR
  EAVWLTDNTYKYEDLVRMMGEIVSALEGKIRVPTVVDYKEVLLTLVPVELRTQHLCSFLCELSLLHTSLSAYAPA
  RLAAAALLLARLTHGQTQPWTTQLWDLTGFSYEDLIPCVLSLHKKCFHDDAPKDYRQVSLTAVKQRFEDKRYGEI
  SQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHAFLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEETL
  LGSFLDWSLDCCSGYEGDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDT
  QIPATPGPKPLVRTSREPGKDVTTSGYSSVSTASPTSSVDGGLGALPQPTSVLSLDSDSHTQPCHHQARKSCLQC
  RPPSPPESSVPQQQVKRINLCIHSEEEDMNLGLVRL

• Structural information:
  • Protein Domains: (29..7-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080-)
    (292..40-)
    (/note="Cyclin-N-terminal")
  • Interpro: IPR028857  IPR039361  IPR013763  IPR036915  IPR004367   IPR006671  IPR036047  IPR001810  IPR011990  
  • Prosite: PS00292 PS50181
  • CDD: cd00043
  • DIP: 44939
  • STRING: ENSP00000380256
• Other Databases: GeneCards:  CCNF  Malacards:  CCNF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0044772	mitotic cell cycle phase transition	IBA	biological process
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IBA	molecular function
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0010826	negative regulation of centrosome duplication	IDA	biological process
GO:0005814	centriole	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001890	placenta development	IEA	biological process
GO:0000320	re-entry into mitotic cell cycle	IEA	biological process
GO:0010826	negative regulation of centrosome duplication	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq