• Gene id: 8989

Gene Summary

• Gene Symbol: TRPA1   Gene   UCSC   Ensembl
• Aliases: ANKTM1, FEPS, FEPS1
• Gene name: transient receptor potential cation channel subfamily A member 1
• Alternate names: transient receptor potential cation channel subfamily A member 1, ankyrin-like with transmembrane domains 1, transformation-sensitive protein p120, wasabi receptor,
• Gene location: 8q21.11 (72094884: 72021249)     Exons: 29     NC_000008.11
• Gene summary(Entrez): The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in si
• OMIM: 604775

Protein Summary

• Protein general information: O75762  
  • Name: Transient receptor potential cation channel subfamily A member 1 (Ankyrin like with transmembrane domains protein 1) (Transformation sensitive protein p120) (Wasabi receptor)
  • Length: 1119  
  • Mass: 127501
  • Tissue specificity: Expressed at very low level in human fibroblasts and at a moderate level in liposarcoma cells (PubMed
• Sequence:

  MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCDDMDTFFLHYAAAEGQ
  IELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSRGANPNLRNFNMMAPLHIAVQGMNNEVMKVL
  LEHRTIDVNLEGENGNTAVIIACTTNNSEALQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHG
  YSRQLHINFMNNGKATPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVD
  IVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNLLLSKGAQVDIKDNFG
  RNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYACRQGGPGSVNNLLGFNVSIHSKSKDKKSPL
  HFAASYGRINTCQRLLQDISDTRLLNEGDLHGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGG
  YTQTMKVILDTNLKCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTII
  RSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNFKYLQCPLEFTKKTPT
  QDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHMMNLGSYCLGLIPMTILVVNIKPGMAFNSTG
  IINETSDHSEILDTTNSYLIKTCMILVFLSSIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVE
  IPAHLQWQCGAIAVYFYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSS
  PLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKR
  IAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYR
  LKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  IPR005821  
  • Prosite: PS50297 PS50088
  • PDB: 3J9P 6HC8 6PQO 6PQP 6PQQ
  • PDBsum: 3J9P 6HC8 6PQO 6PQP 6PQQ
  • DIP: 61520
  • STRING: ENSP00000262209
• Other Databases: GeneCards:  TRPA1  Malacards:  TRPA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051289	protein homotetramerization	IDA	biological process
GO:0015278	calcium-release channel activity	IDA	molecular function
GO:0097604	temperature-gated cation channel activity	IDA	molecular function
GO:0010033	response to organic substance	IMP	biological process
GO:0070588	calcium ion transmembrane transport	IMP	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0015278	calcium-release channel activity	IMP	molecular function
GO:0070588	calcium ion transmembrane transport	IMP	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0019233	sensory perception of pain	IMP	biological process
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015267	channel activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006811	ion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0070588	calcium ion transmembrane transport	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0009409	response to cold	IEA	biological process
GO:0032421	stereocilium bundle	IEA	cellular component
GO:0042493	response to drug	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0048265	response to pain	IEA	biological process
GO:0050968	detection of chemical stimulus involved in sensory perception of pain	IEA	biological process
GO:0005262	calcium channel activity	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0015267	channel activity	IEA	molecular function
GO:0050955	thermoception	IEA	biological process
GO:0050966	detection of mechanical stimulus involved in sensory perception of pain	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0051209	release of sequestered calcium ion into cytosol	IEA	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04750	Inflammatory mediator regulation of TRP channels

Diseases

Associated diseases	References
Familial episodic pain syndrome	KEGG:H01391
Familial episodic pain syndrome	KEGG:H01391
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881