• Gene id: 89885

Gene Summary

• Gene Symbol: FATE1   Gene   UCSC   Ensembl
• Aliases: CT43, FATE
• Gene name: fetal and adult testis expressed 1
• Alternate names: fetal and adult testis-expressed transcript protein, BJ-HCC-2 antigen, cancer/testis antigen 43, tumor antigen BJ-HCC-2,
• Gene location: Xq28 (151716035: 151723193)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene encodes a cancer-testis antigen that is highly expressed in hepatocellular carcinomas and other tumors and weakly expressed in normal tissues except testis. The protein is strongly expressed in spermatogonia, primary spermatocytes, and Sertoli c
• OMIM: 300450

Protein Summary

• Protein general information: Q969F0  
  • Name: Fetal and adult testis expressed transcript protein (Cancer/testis antigen 43) (CT43) (Tumor antigen BJ HCC 2)
  • Length: 183  
  • Mass: 20,712
• Sequence:

  MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNMTATRP
  KKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQLYAVNRRLRA
  LEEQGATWRHRETLIIAVLVSASIANLWLWMNQ

• Structural information:
  • STRING: ENSP00000359375
• Other Databases: GeneCards:  FATE1  Malacards:  FATE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 12811541
Male infertility	MIK: 12811541

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12811541	Male infertility	FATE (741C-->T, 905A-->C, 3985C-->T, A10V, S125R, I34T)		144 infertile males	Male infertility	FATE
12811541	Male infertility	741C-->T, 905A-->C, 3985C-->T, A10 V, S125R, I34T		144 infertile males	Male infertility	FATE