• Gene id: 89882

Gene Summary

• Gene Symbol: TPD52L3   Gene   UCSC   Ensembl
• Aliases: D55, NYDSP25, TPD55, hD55
• Gene name: TPD52 like 3
• Alternate names: tumor protein D55, protein kinase NYD-SP25, testis development protein NYD-SP25, testis tissue sperm-binding protein Li 87P, tumor protein D52 like 3,
• Gene location: 9p24.1 (6328369: 6331890)     Exons: 3     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded p
• OMIM: 617567

Protein Summary

• Protein general information: Q96J77  
  • Name: Tumor protein D55 (hD55) (Testis development protein NYD SP25) (Tumor protein D52 like 3)
  • Length: 140  
  • Mass: 15503
  • Tissue specificity: Specifically expressed in testis. Expressed at 5.6-fold higher levels in adult testis than in fetal testis. {ECO
• Sequence:

  MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQN
  LSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATFRSFEGLMGTIKSKVSGGKRAWP

• Structural information:
  • Interpro: IPR007327  
  • STRING: ENSP00000341677
• Other Databases: GeneCards:  TPD52L3  Malacards:  TPD52L3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)