• Gene id: 89874

Gene Summary

• Gene Symbol: SLC25A21   Gene   UCSC   Ensembl
• Aliases: MTDPS18, ODC, ODC1
• Gene name: solute carrier family 25 member 21
• Alternate names: mitochondrial 2-oxodicarboxylate carrier, oxodicarboxylate carrier, solute carrier family 25 (mitochondrial oxoadipate carrier), member 21, solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21,
• Gene location: 14q13.3 (37172605: 36677317)     Exons: 13     NC_000014.9
• Gene summary(Entrez): SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of

Protein Summary

• Protein general information: Q9BQT8  
  • Name: Mitochondrial 2 oxodicarboxylate carrier (Solute carrier family 25 member 21)
  • Length: 299  
  • Mass: 33303
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKG
  ILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQANRNTFAEQPST
  VGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVIN
  IPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW

• Structural information:
  • Interpro: IPR002067  IPR018108  IPR023395  
  • Prosite: PS50920
  • STRING: ENSP00000329452
• Other Databases: GeneCards:  SLC25A21  Malacards:  SLC25A21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005347	ATP transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0015139	alpha-ketoglutarate transmembrane transporter activity	TAS	molecular function
GO:0006554	lysine catabolic process	TAS	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0015867	ATP transport	IEA	biological process
GO:0015742	alpha-ketoglutarate transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray