• Gene id: 89872

Gene Summary

• Gene Symbol: AQP10   Gene   UCSC   Ensembl
• Aliases: AQPA_HUMAN
• Gene name: aquaporin 10
• Alternate names: aquaporin-10, AQP-10, aquaglyceroporin-10, small intestine aquaporin,
• Gene location: 1q21.3 (154321058: 154325324)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-se
• OMIM: 158378

Protein Summary

• Protein general information: Q96PS8  
  • Name: Aquaporin 10 (AQP 10) (Aquaglyceroporin 10) (Small intestine aquaporin)
  • Length: 301  
  • Mass: 31763
  • Tissue specificity: Detected in epithelial cells on villi in the ileum, and also in stomach, jejunum, colon, rectum, white adipose tissue and placenta (at protein level) (PubMed
• Sequence:

  MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGN
  VSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKETASIFATYP
  APYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFT
  YVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
  L

• Structural information:
  • Interpro: IPR023271  IPR026252  IPR000425  IPR022357  
  • Prosite: PS00221
  • CDD: cd00333
  • PDB: 6F7H
  • PDBsum: 6F7H
  • STRING: ENSP00000318355
• Other Databases: GeneCards:  AQP10  Malacards:  AQP10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015204	urea transmembrane transporter activity	IBA	molecular function
GO:0051289	protein homotetramerization	IDA	biological process
GO:0015254	glycerol channel activity	IDA	molecular function
GO:0015250	water channel activity	IDA	molecular function
GO:0015793	glycerol transport	IDA	biological process
GO:0071468	cellular response to acidic pH	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006833	water transport	IDA	biological process
GO:0015267	channel activity	IEA	molecular function
GO:0006833	water transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006833	water transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005811	lipid droplet	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0071918	urea transmembrane transport	IEA	biological process
GO:0009636	response to toxic substance	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881