• Gene id: 89866

Gene Summary

• Gene Symbol: SEC16B   Gene   UCSC   Ensembl
• Aliases: LZTR2, PGPR-p117, RGPR, RGPR-p117, SEC16S
• Gene name: SEC16 homolog B, endoplasmic reticulum export factor
• Alternate names: protein transport protein Sec16B, leucine zipper transcription regulator 2, protein SEC16 homolog B, regucalcin gene promoter region-related protein p117, regucalcin gene promotor region related protein,
• Gene location: 1q25.2 (177984302: 177928787)     Exons: 28     NC_000001.11
• Gene summary(Entrez): SEC16B is a mammalian homolog of S. cerevisiae Sec16 that is required for organization of transitional endoplasmic reticulum (ER) sites and protein export (Bhattacharyya and Glick, 2007 [PubMed 17192411]).[supplied by OMIM, Jun 2009]
• OMIM: 616621

Protein Summary

• Protein general information: Q96JE7  
  • Name: Protein transport protein Sec16B (Leucine zipper transcription regulator 2) (Regucalcin gene promoter region related protein p117) (RGPR p117) (SEC16 homolog B)
  • Length: 1060  
  • Mass: 116604
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MELWAPQRLPQTRGKATAPSKDPDRGFRRDGHHRPVPHSWHNGERFHQWQDNRGSPQPQQEPRADHQQQPHYASR
  PGDWHQPVSGVDYYEGGYRNQLYSRPGYENSYQSYQSPTMREEYAYGSYYYHGHPQWLQEERVPRQRSPYIWHED
  YREQKYLDEHHYENQHSPFGTNSETHFQSNSRNPCKDSPASNSGQEWPGELFPGSLLAEAQKNKPSLASESNLLQ
  QRESGLSSSSYELSQYIRDAPERDDPPASAAWSPVQADVSSAGPKAPMKFYIPHVPVSFGPGGQLVHVGPSSPTD
  GQAALVELHSMEVILNDSEEQEEMRSFSGPLIREDVHKVDIMTFCQQKAAQSCKSETLGSRDSALLWQLLVLLCR
  QNGSMVGSDIAELLMQDCKKLEKYKRQPPVANLINLTDEDWPVLSSGTPNLLTGEIPPSVETPAQIVEKFTRLLY
  YGRKKEALEWAMKNHLWGHALFLSSKMDPQTYSWVMSGFTSTLALNDPLQTLFQLMSGRIPQAATCCGEKQWGDW
  RPHLAVILSNQAGDPELYQRAIVAIGDTLAGKGLVEAAHFCYLMAHVPFGHYTVKTDHLVLLGSSHSQEFLKFAT
  TEAIQRTEIFEYCQMLGRPKSFIPSFQVYKLLYASRLADYGLVSQALHYCEAIGAAVLSQGESSHPVLLVELIKL
  AEKLKLSDPLVLERRSGDRDLEPDWLAQLRRQLEQKVAGDIGDPHPTRSDISGAGGTTTENTFYQDFSGCQGYSE
  APGYRSALWLTPEQTCLLQPSPQQPFPLQPGSYPAGGGAGQTGTPRPFYSVPETHLPGTGSSVAVTEATGGTVWE
  EMLQTHLGPGENTVSQETSQPPDGQEVISKPQTPLAARPRSISESSASSAKEDEKESSDEADKNSPRNTAQRGKL
  GDGKEHTKSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLSLTPSPESPPLPDVSAFSR
  GRGGGEGRGSASSGGAAAGAGVGGLSGPESVSFELCSNPGVLLPPPALKGAVPLYNPSQVPQLPTATSLNRPNRL
  AQRRYPTQPC

• Structural information:
  • Interpro: IPR024298  IPR024880  IPR024340  
  • CDD: cd09233
  • STRING: ENSP00000308339
• Other Databases: GeneCards:  SEC16B  Malacards:  SEC16B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007029	endoplasmic reticulum organization	IBA	biological process
GO:0007030	Golgi organization	IBA	biological process
GO:0070863	positive regulation of protein exit from endoplasmic reticulum	IBA	biological process
GO:0070971	endoplasmic reticulum exit site	IBA	cellular component
GO:0012507	ER to Golgi transport vesicle membrane	IBA	cellular component
GO:0048208	COPII vesicle coating	IBA	biological process
GO:0070973	protein localization to endoplasmic reticulum exit site	IBA	biological process
GO:0070971	endoplasmic reticulum exit site	IDA	cellular component
GO:0070971	endoplasmic reticulum exit site	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0048208	COPII vesicle coating	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0007031	peroxisome organization	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0007029	endoplasmic reticulum organization	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0007031	peroxisome organization	IDA	biological process
GO:0070863	positive regulation of protein exit from endoplasmic reticulum	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0016559	peroxisome fission	IMP	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray