• Gene id: 8985

Gene Summary

• Gene Symbol: PLOD3   Gene   UCSC   Ensembl
• Aliases: LH3
• Gene name: procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
• Alternate names: multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3, lysine hydroxylase 3, lysyl hydroxlase 3, lysyl hydroxylase 3,
• Gene location: 7q22.1 (101217580: 101205983)     Exons: 19     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptide

Protein Summary

• Protein general information: O60568  
  • Name: Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 [Includes: Procollagen lysine,2 oxoglutarate 5 dioxygenase 3 (EC 1.14.11.4) (Lysyl hydroxylase 3) (LH3); Procollagen glycosyltransferase (EC 2.4.1.50) (EC 2.4.1.66) (Galactosylhydr
  • Length: 738  
  • Mass: 84785
  • Tissue specificity: Ubiquitous (PubMed
• Sequence:

  MTSSGPGPRFLLLLPLLLPPAASASDRPRGRDPVNPEKLLVITVATAETEGYLRFLRSAEFFNYTVRTLGLGEEW
  RGGDVARTVGGGQKVRWLKKEMEKYADREDMIIMFVDSYDVILAGSPTELLKKFVQSGSRLLFSAESFCWPEWGL
  AEQYPEVGTGKRFLNSGGFIGFATTIHQIVRQWKYKDDDDDQLFYTRLYLDPGLREKLSLNLDHKSRIFQNLNGA
  LDEVVLKFDRNRVRIRNVAYDTLPIVVHGNGPTKLQLNYLGNYVPNGWTPEGGCGFCNQDRRTLPGGQPPPRVFL
  AVFVEQPTPFLPRFLQRLLLLDYPPDRVTLFLHNNEVFHEPHIADSWPQLQDHFSAVKLVGPEEALSPGEARDMA
  MDLCRQDPECEFYFSLDADAVLTNLQTLRILIEENRKVIAPMLSRHGKLWSNFWGALSPDEYYARSEDYVELVQR
  KRVGVWNVPYISQAYVIRGDTLRMELPQRDVFSGSDTDPDMAFCKSFRDKGIFLHLSNQHEFGRLLATSRYDTEH
  LHPDLWQIFDNPVDWKEQYIHENYSRALEGEGIVEQPCPDVYWFPLLSEQMCDELVAEMEHYGQWSGGRHEDSRL
  AGGYENVPTVDIHMKQVGYEDQWLQLLRTYVGPMTESLFPGYHTKARAVMNFVVRYRPDEQPSLRPHHDSSTFTL
  NVALNHKGLDYEGGGCRFLRYDCVISSPRKGWALLHPGRLTHYHEGLPTTWGTRYIMVSFVDP

• Structural information:
  • Protein Domains: (647..73-)
    (/note="Fe2OG-dioxygenase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00805"-)
  • Interpro: IPR029044  IPR005123  IPR006620  IPR001006  
  • Prosite: PS51471 PS01325
  • PDB: 6FXK 6FXM 6FXR 6FXT 6FXX 6FXY
  • PDBsum: 6FXK 6FXM 6FXR 6FXT 6FXX 6FXY
  • STRING: ENSP00000223127
• Other Databases: GeneCards:  PLOD3  Malacards:  PLOD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0017185	peptidyl-lysine hydroxylation	IBA	biological process
GO:0008475	procollagen-lysine 5-dioxygenase activity	IBA	molecular function
GO:0033823	procollagen glucosyltransferase activity	IBA	molecular function
GO:0005615	extracellular space	ISS	cellular component
GO:0017185	peptidyl-lysine hydroxylation	IMP	biological process
GO:0008475	procollagen-lysine 5-dioxygenase activity	IMP	molecular function
GO:0033823	procollagen glucosyltransferase activity	IMP	molecular function
GO:0050211	procollagen galactosyltransferase activity	IMP	molecular function
GO:0005506	iron ion binding	IEA	molecular function
GO:0031418	L-ascorbic acid binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0008475	procollagen-lysine 5-dioxygenase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0031418	L-ascorbic acid binding	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008475	procollagen-lysine 5-dioxygenase activity	IEA	molecular function
GO:0033823	procollagen glucosyltransferase activity	IEA	molecular function
GO:0050211	procollagen galactosyltransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0050211	procollagen galactosyltransferase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032963	collagen metabolic process	IEA	biological process
GO:0021915	neural tube development	IEA	biological process
GO:0017185	peptidyl-lysine hydroxylation	IEA	biological process
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0001886	endothelial cell morphogenesis	IEA	biological process
GO:0070831	basement membrane assembly	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0048730	epidermis morphogenesis	IEA	biological process
GO:0046947	hydroxylysine biosynthetic process	IEA	biological process
GO:0042311	vasodilation	IEA	biological process
GO:0033823	procollagen glucosyltransferase activity	IEA	molecular function
GO:0030199	collagen fibril organization	IEA	biological process
GO:0008475	procollagen-lysine 5-dioxygenase activity	IEA	molecular function
GO:0008104	protein localization	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0032870	cellular response to hormone stimulus	IEA	biological process
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006493	protein O-linked glycosylation	IMP	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0017185	peptidyl-lysine hydroxylation	IMP	biological process
GO:0017185	peptidyl-lysine hydroxylation	IDA	biological process
GO:0017185	peptidyl-lysine hydroxylation	IDA	biological process
GO:0008475	procollagen-lysine 5-dioxygenase activity	IMP	molecular function
GO:0033823	procollagen glucosyltransferase activity	IMP	molecular function
GO:0008475	procollagen-lysine 5-dioxygenase activity	IDA	molecular function
GO:0008475	procollagen-lysine 5-dioxygenase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00310	Lysine degradation
hsa00514	Other types of O-glycan biosynthesis

Diseases

Associated diseases	References
Lysyl hydroxylase 3 deficiency	KEGG:H01192
Lysyl hydroxylase 3 deficiency	KEGG:H01192
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881