• Gene id: 89822

Gene Summary

• Gene Symbol: KCNK17   Gene   UCSC   Ensembl
• Aliases: K2p17.1, TALK-2, TALK2, TASK-4, TASK4
• Gene name: potassium two pore domain channel subfamily K member 17
• Alternate names: potassium channel subfamily K member 17, 2P domain potassium channel Talk-2, TWIK-related acid-sensitive K(+) channel 4, TWIK-related alkaline pH-activated K(+) channel 2, acid-sensitive potassium channel protein TASK-4, potassium channel, two pore domain,
• Gene location: 6p21.2 (39314460: 39299000)     Exons: 6     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. This gene is activa
• OMIM: 607370

Protein Summary

• Protein general information: Q96T54  
  • Name: Potassium channel subfamily K member 17 (2P domain potassium channel Talk 2) (Acid sensitive potassium channel protein TASK 4) (TWIK related acid sensitive K(+) channel 4) (TWIK related alkaline pH activated K(+) channel 2) (TALK 2)
  • Length: 332  
  • Mass: 36,895
• Sequence:

  MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLDRPALD
  SLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNR
  LGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFG
  DYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPES
  HSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS

• Structural information:
  • Interpro: IPR003280  IPR003092  IPR013099  
  • STRING: ENSP00000362328
• Other Databases: GeneCards:  KCNK17  Malacards:  KCNK17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IDA	molecular function
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006813	potassium ion transport	IDA	biological process
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IDA	molecular function
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006810	transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0006813	potassium ion transport	IEA	biological process
GO:0006813	potassium ion transport	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	IDA	molecular function
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006813	potassium ion transport	IDA	biological process
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0030322	stabilization of membrane potential	IBA	biological process

Diseases

Associated diseases	References
Brain ischemia	GAD: 19910543
Diabetes	GAD: 22158537
Diabetes	GAD: 22158537
Stroke	GAD: 17434096
Stroke	GAD: 17434096
Male factor infertility	MIK: 17928628
Azoospermia	MIK: 17928628
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 17928628
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17928628	Azoospermia				Male infertility	CRISP1 SPINLW1 FAM12B DEFB129 CFTR AQP5 KCNK4 KCNK17 SLC6A20 SLC13A3 DEFB126 and DEFB106A
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq