• Gene id: 89792

Gene Summary

• Gene Symbol: GAL3ST3   Gene   UCSC   Ensembl
• Aliases: GAL3ST-3, GAL3ST2
• Gene name: galactose-3-O-sulfotransferase 3
• Alternate names: galactose-3-O-sulfotransferase 3, beta-galactose-3-O-sulfotransferase 3, gal-beta-1, 3-GalNAc 3'-sulfotransferase 3, galactose 3'-sulfotransferase, galbeta1-3GalNAc 3'-sulfotransferase 3,
• Gene location: 11q13.1 (66049160: 66040764)     Exons: 3     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) ol
• OMIM: 608234

Protein Summary

• Protein general information: Q96A11  
  • Name: Galactose 3 O sulfotransferase 3 (Gal3ST 3) (EC 2.8.2. ) (Beta galactose 3 O sulfotransferase 3) (Gal3ST3) (Gal beta 1, 3 GalNAc 3' sulfotransferase 3)
  • Length: 431  
  • Mass: 48956
  • Tissue specificity: Highly expressed in thyroid, brain, kidney, heart and spinal cord. {ECO
• Sequence:

  MPPILQRLQQATKMMSRRKILLLVLGCSTVSLLIHQGAQLSWYPKLFPLSCPPLRNSPPRPKHMTVAFLKTHKTA
  GTTVQNILFRFAERHNLTVALPHPSCEHQFCYPRNFSAHFVHPATRPPHVLASHLRFDRAELERLMPPSTVYVTI
  LREPAAMFESLFSYYNQYCPAFRRVPNASLEAFLRAPEAYYRAGEHFAMFAHNTLAYDLGGDNERSPRDDAAYLA
  GLIRQVEEVFSLVMIAEYFDESLVLLRRLLAWDLDDVLYAKLNARAASSRLAAIPAALARAARTWNALDAGLYDH
  FNATFWRHVARAGRACVEREARELREARQRLLRRCFGDEPLLRPAAQIRTKQLQPWQPSRKVDIMGYDLPGGGAG
  PATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEPVLDNPPPRPIRVLPRGPQGP

• Structural information:
  • Interpro: IPR009729  IPR027417  
  • STRING: ENSP00000308591
• Other Databases: GeneCards:  GAL3ST3  Malacards:  GAL3ST3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008146	sulfotransferase activity	IBA	molecular function
GO:0050694	galactose 3-O-sulfotransferase activity	IBA	molecular function
GO:0001733	galactosylceramide sulfotransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0009247	glycolipid biosynthetic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0050694	galactose 3-O-sulfotransferase activity	IDA	molecular function
GO:0050656	3'-phosphoadenosine 5'-phosphosulfate binding	NAS	molecular function
GO:0030309	poly-N-acetyllactosamine metabolic process	NAS	biological process
GO:0030246	carbohydrate binding	NAS	molecular function
GO:0030166	proteoglycan biosynthetic process	NAS	biological process
GO:0009311	oligosaccharide metabolic process	NAS	biological process
GO:0006790	sulfur compound metabolic process	NAS	biological process
GO:0050694	galactose 3-O-sulfotransferase activity	IMP	molecular function
GO:0005996	monosaccharide metabolic process	NAS	biological process
GO:0030309	poly-N-acetyllactosamine metabolic process	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0009311	oligosaccharide metabolic process	NAS	biological process
GO:0050698	proteoglycan sulfotransferase activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881