• Gene id: 89790

Gene Summary

• Gene Symbol: SIGLEC10   Gene   UCSC   Ensembl
• Aliases: PRO940, SIGLEC-10, SLG2
• Gene name: sialic acid binding Ig like lectin 10
• Alternate names: sialic acid-binding Ig-like lectin 10, sialic acid binding Ig-like lectin 10 Ig-like lectin 7, siglec-like gene 2, siglec-like protein 2,
• Gene location: 19q13.41 (51417641: 51410019)     Exons: 11     NC_000019.10
• Gene summary(Entrez): SIGLECs are members of the immunoglobulin superfamily that are expressed on the cell surface. Most SIGLECs have 1 or more cytoplasmic immune receptor tyrosine-based inhibitory motifs, or ITIMs. SIGLECs are typically expressed on cells of the innate immune
• OMIM: 607779

Protein Summary

• Protein general information: Q96LC7  
  • Name: Sialic acid binding Ig like lectin 10 (Siglec 10) (Siglec like protein 2)
  • Length: 697  
  • Mass: 76592
  • Tissue specificity: Expressed by peripheral blood leukocytes (eosinophils, monocytes and a natural killer cell subpopulation). Isoform 5 is found to be the most abundant isoform. Found in lymph node, lung, ovary and appendix. Isoform 1 is found at high le
• Sequence:

  MLLPLLLSSLLGGSQAMDGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVAT
  NHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRVERGSYVRYNFMNDGFFLKVTALTQKPDVYI
  PETLEPGQPVTVICVFNWAFEECPPPSFSWTGAALSSQGTKPTTSHFSVLSFTPRPQDHNTDLTCHVDFSRKGVS
  AQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYLEAQKGQFLRLLCAADSQPPATLSWVLQNRVLSSSHP
  WGPRPLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLGNGTSLPVLEGQS
  LCLVCVTHSSPPARLSWTQRGQVLSPSQPSDPGVLELPRVQVEHEGEFTCHARHPLGSQHVSLSLSVHYSPKLLG
  PSCSWEAEGLHCSCSSQASPAPSLRWWLGEELLEGNSSQDSFEVTPSSAGPWANSSLSLHGGLSSGLRLRCEAWN
  VHGAQSGSILQLPDKKGLISTAFSNGAFLGIGITALLFLCLALIIMKILPKRRTQTETPRPRFSRHSTILDYINV
  VPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGV
  RPRPEARMPKGTQADYAEVKFQ

• Structural information:
  • Protein Domains: (18..12-)
    (/note="Ig-like-V-type)
    (146..23-)
    1 (/note="Ig-like-C2-type)
    (251..33-)
    2 (/note="Ig-like-C2-type)
    (344..44-)
    3" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003006  IPR003599   IPR003598  IPR013106  
  • Prosite: PS50835 PS00290
  • STRING: ENSP00000345243
• Other Databases: GeneCards:  SIGLEC10  Malacards:  SIGLEC10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033691	sialic acid binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0042169	SH2 domain binding	IMP	molecular function
GO:0019902	phosphatase binding	IPI	molecular function
GO:0106015	negative regulation of inflammatory response to wounding	IPI	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray