• Gene id: 89782

Gene Summary

• Gene Symbol: LMLN   Gene   UCSC   Ensembl
• Aliases: GP63, INV, IX14, LMNL1, MSP
• Gene name: leishmanolysin like peptidase
• Alternate names: leishmanolysin-like peptidase, invadolysin, leishmanolysin-2, leishmanolysin-like (metallopeptidase M8 family),
• Gene location: 3q29 (197960199: 198043719)     Exons: 17     NC_000003.12
• Gene summary(Entrez): This gene encodes a zinc-metallopeptidase. The encoded protein may play a role in cell migration and invasion. Studies of a similar protein in Drosophila indicate a potential role in mitotic progression. Alternatively spliced transcript variants have been
• OMIM: 617103

Protein Summary

• Protein general information: Q96KR4  
  • Name: Leishmanolysin like peptidase (EC 3.4.24. ) (Invadolysin)
  • Length: 655  
  • Mass: 73568
  • Tissue specificity: Expressed in all cell lines analyzed. {ECO
• Sequence:

  MVTTLGPKMAAEWGGGVGYSGSGPGRSRWRWSGSVWVRSVLLLLGGLRASATSTPVSLGSSPPCRHHVPSDTEVI
  NKVHLKANHVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQ
  YLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYRGGKWPHGAVGVPDQEGISDADFVLYVGALATERCSH
  ENIISYAAYCQQEANMDRPIAGYANLCPNMISTQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRF
  ADGLPPFNYSLGLYQWSDKVVRKVERLWDVRDNKIVRHTVYLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTE
  LNHWEKRLLENEAMTGSHTQNRVLSRITLALMEDTGRQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPL
  PQEYQYFDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVC
  LIQKSAFVMEKCERKLSYPDWGSGCYQVSCSPQGLKVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLCPSCWD
  FCELCPPETDPPATNLTRALPLDLCSCSSSLVVTLWLLLGNLFPLLAGFLLCIWH

• Structural information:
  • Interpro: IPR001577  
  • STRING: ENSP00000410926
• Other Databases: GeneCards:  LMLN  Malacards:  LMLN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008233	peptidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005811	lipid droplet	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq