• Gene id: 8976

Gene Summary

• Gene Symbol: WASL   Gene   UCSC   Ensembl
• Aliases: N-WASP, NWASP, WASPB
• Gene name: Wiskott-Aldrich syndrome like
• Alternate names: neural Wiskott-Aldrich syndrome protein,
• Gene location: 7q31.32 (123749070: 123681926)     Exons: 11     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the Wiskott-Aldrich syndrome (WAS) protein family. Wiskott-Aldrich syndrome proteins share similar domain structure, and associate with a variety of signaling molecules to alter the actin cytoskeleton. The encoded protein is
• OMIM: 605056

Protein Summary

• Protein general information: O00401  
  • Name: Neural Wiskott Aldrich syndrome protein (N WASP)
  • Length: 505  
  • Mass: 54,827
• Sequence:

  MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRS
  YFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRD
  PPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDL
  NNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP
  PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPP
  PPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSV
  ADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED

• Structural information:
  • Protein Domains: WH1. (34-141)
    CRIB. (203-216)
    WH2 (405-422)
    WH2 (433-450)
  • Interpro: IPR000095  IPR036936  IPR030214  IPR011993  IPR011026   IPR033927  IPR000697  IPR003124  
  • Prosite: PS50108 PS50229 PS51082
  • CDD: cd00132 cd01205
  • PDB: 2FF3 2LNH 2VCP 4CC2 4CC7
  • PDBsum: 2FF3 2LNH 2VCP 4CC2 4CC7
  • DIP: 29042
  • STRING: ENSP00000223023
• Other Databases: GeneCards:  WASL  Malacards:  WASL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006461	protein complex assembly	TAS	biological process
GO:0006900	membrane budding	ISS	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0008154	actin polymerization or depolymerization	TAS	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0016050	vesicle organization	ISS	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0030050	vesicle transport along actin filament	ISS	biological process
GO:0030478	actin cap	IEA	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030695	GTPase regulator activity	TAS	molecular function
GO:0032880	regulation of protein localization	IEA	biological process
GO:0034629	cellular protein complex localization	IEA	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0050999	regulation of nitric-oxide synthase activity	TAS	biological process
GO:0051301	cell division	IEA	biological process
GO:0051491	positive regulation of filopodium assembly	ISS	biological process
GO:0051653	spindle localization	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1903526	negative regulation of membrane tubulation	IDA	biological process
GO:2000370	positive regulation of clathrin-dependent endocytosis	ISS	biological process
GO:2000402	negative regulation of lymphocyte migration	IMP	biological process
GO:2000601	positive regulation of Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006461	protein complex assembly	TAS	biological process
GO:0006900	membrane budding	ISS	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0007015	actin filament organization	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0008154	actin polymerization or depolymerization	TAS	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0016050	vesicle organization	ISS	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0030050	vesicle transport along actin filament	ISS	biological process
GO:0030478	actin cap	IEA	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030695	GTPase regulator activity	TAS	molecular function
GO:0032880	regulation of protein localization	IEA	biological process
GO:0034629	cellular protein complex localization	IEA	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0050999	regulation of nitric-oxide synthase activity	TAS	biological process
GO:0051301	cell division	IEA	biological process
GO:0051491	positive regulation of filopodium assembly	ISS	biological process
GO:0051653	spindle localization	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1903526	negative regulation of membrane tubulation	IDA	biological process
GO:2000370	positive regulation of clathrin-dependent endocytosis	ISS	biological process
GO:2000402	negative regulation of lymphocyte migration	IMP	biological process
GO:2000601	positive regulation of Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006461	protein complex assembly	TAS	biological process
GO:0006900	membrane budding	ISS	biological process
GO:0006928	movement of cell or subcellular component	TAS	biological process
GO:0008154	actin polymerization or depolymerization	TAS	biological process
GO:0015629	actin cytoskeleton	TAS	cellular component
GO:0016050	vesicle organization	ISS	biological process
GO:0030050	vesicle transport along actin filament	ISS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030695	GTPase regulator activity	TAS	molecular function
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0050999	regulation of nitric-oxide synthase activity	TAS	biological process
GO:0051491	positive regulation of filopodium assembly	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1903526	negative regulation of membrane tubulation	IDA	biological process
GO:2000370	positive regulation of clathrin-dependent endocytosis	ISS	biological process
GO:2000402	negative regulation of lymphocyte migration	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04520	Adherens junction
hsa04810	Regulation of actin cytoskeleton
hsa05130	Pathogenic Escherichia coli infection
hsa05132	Salmonella infection
hsa05131	Shigellosis
hsa05135	Yersinia infection
hsa05100	Bacterial invasion of epithelial cells

Diseases

Associated diseases	References
Azoospermia	MIK: 21503600
Idiopathic azoospermia	MIK: 21503600
Role in spermatogenesis	MIK: 17573773
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21503600	Idiopathic azoospermia				Male infertility	N-WASP
17573773	Role in spermatogenesis				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)