• Gene id: 896

Gene Summary

• Gene Symbol: CCND3   Gene   UCSC   Ensembl
• Gene name: cyclin D3
• Alternate names: G1/S-specific cyclin-D3, D3-type cyclin,
• Gene location: 6p21.1 (42048893: 41934932)     Exons: 7     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
• OMIM: 607571

SNPs

rs2227973

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.36575763A>G
NC_000011.10   g.36575763A>T
NC_000011.9   g.36597313A>G
NC_000011.9   g.36597313A>T
NG_007528.1   g.12751A>G
NG_007528.1   g.12751A>T
NM_000448.3   c.2459A>G
NM_000448.3   c.2459A>T
NM_000448.2   c.2459A>G
NM_000448.2   c.2459A>T
NP_000439.  

Protein Summary

• Protein general information: P30281  
  • Name: G1/S specific cyclin D3
  • Length: 292  
  • Mass: 32520
• Sequence:

  MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEE
  EVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKW
  DLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDEL
  TELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

• Structural information:
  • Protein Domains: (27..15-)
    (/note="Cyclin-N-terminal")
  • Interpro: IPR039361  IPR013763  IPR036915  IPR004367  IPR015451   IPR006671  
  • Prosite: PS00292
  • CDD: cd00043
  • PDB: 3G33
  • PDBsum: 3G33
  • DIP: 31734
  • STRING: ENSP00000362082
• Other Databases: GeneCards:  CCND3  Malacards:  CCND3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	IBA	molecular function
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IBA	cellular component
GO:0044772	mitotic cell cycle phase transition	IBA	biological process
GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	IBA	biological process
GO:0042025	host cell nucleus	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0046626	regulation of insulin receptor signaling pathway	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0042098	T cell proliferation	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase activity	IEA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0000307	cyclin-dependent protein kinase holoenzyme complex	IDA	cellular component
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa05166	Human T-cell leukemia virus 1 infection
hsa04510	Focal adhesion
hsa05203	Viral carcinogenesis
hsa05169	Epstein-Barr virus infection
hsa04310	Wnt signaling pathway
hsa04390	Hippo signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa05164	Influenza A
hsa04218	Cellular senescence
hsa04110	Cell cycle
hsa05162	Measles
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Multiple myeloma	KEGG:H00010
Multiple myeloma	KEGG:H00010
Prostate cancer	PMID:18317945
urinary bladder cancer	PMID:16482499
Cervix carcinoma	PMID:14751136
invasive ductal carcinoma	PMID:11329139
Ovary adenocarcinoma	PMID:17885491
renal cell carcinoma	PMID:18679818
multiple myeloma	PMID:15755896
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray