• Gene id: 8945

Gene Summary

• Gene Symbol: BTRC   Gene   UCSC   Ensembl
• Aliases: BETA-TRCP, FBW1A, FBXW1, FBXW1A, FWD1, bTrCP, bTrCP1, betaTrCP
• Gene name: beta-transducin repeat containing E3 ubiquitin protein ligase
• Alternate names: F-box/WD repeat-containing protein 1A, E3RSIkappaB, F-box and WD repeats protein beta-TrCP, F-box and WD-repeat protein 1B, beta-TrCP1, epididymis tissue protein Li 2a, pIkappaBalpha-E3 receptor subunit,
• Gene location: 10q24.32 (101353807: 101557320)     Exons: 21     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w
• OMIM: 603482

Protein Summary

• Protein general information: Q9Y297  
  • Name: F box/WD repeat containing protein 1A (E3RSIkappaB) (Epididymis tissue protein Li 2a) (F box and WD repeats protein beta TrCP) (pIkappaBalpha E3 receptor subunit)
  • Length: 605  
  • Mass: 68867
  • Tissue specificity: Expressed in epididymis (at protein level). {ECO
• Sequence:

  MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRKIIPEKNS
  LRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQV
  EFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLW
  KKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS
  ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEM
  LNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKV
  WNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYD
  GKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTY
  TYISR

• Structural information:
  • Protein Domains: (190..22-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR021977  IPR036047  IPR001810  IPR020472  IPR015943   IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS50181 PS00678 PS50082 PS50294
  • PDB: 1P22 2P64 6M90 6M91 6M92 6M93 6M94
  • PDBsum: 1P22 2P64 6M90 6M91 6M92 6M93 6M94
  • DIP: 31607
  • STRING: ENSP00000359206
• Other Databases: GeneCards:  BTRC  Malacards:  BTRC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990756	ubiquitin ligase-substrate adaptor activity	IDA	molecular function
GO:0008013	beta-catenin binding	IDA	molecular function
GO:1904668	positive regulation of ubiquitin protein ligase activity	IDA	biological process
GO:1990757	ubiquitin ligase activator activity	IDA	molecular function
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IC	biological process
GO:0000209	protein polyubiquitination	IMP	biological process
GO:0016567	protein ubiquitination	IBA	biological process
GO:0019005	SCF ubiquitin ligase complex	IBA	cellular component
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0042752	regulation of circadian rhythm	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0042753	positive regulation of circadian rhythm	ISS	biological process
GO:0006470	protein dephosphorylation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	ISS	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016874	ligase activity	IEA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0038061	NIK/NF-kappaB signaling	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0070498	interleukin-1-mediated signaling pathway	TAS	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0051403	stress-activated MAPK cascade	TAS	biological process
GO:1901990	regulation of mitotic cell cycle phase transition	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045309	protein phosphorylated amino acid binding	IEA	molecular function
GO:0043122	regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0042753	positive regulation of circadian rhythm	IEA	biological process
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological process
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0061136	regulation of proteasomal protein catabolic process	IEA	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0060444	branching involved in mammary gland duct morphogenesis	IEA	biological process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0030163	protein catabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000209	protein polyubiquitination	IEA	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	TAS	biological process
GO:0045879	negative regulation of smoothened signaling pathway	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	contributes to
GO:0019005	SCF ubiquitin ligase complex	IDA	cellular component
GO:0016567	protein ubiquitination	IDA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0045862	positive regulation of proteolysis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0031648	protein destabilization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa05170	Human immunodeficiency virus 1 infection
hsa04310	Wnt signaling pathway
hsa04120	Ubiquitin mediated proteolysis
hsa04390	Hippo signaling pathway
hsa04218	Cellular senescence
hsa04114	Oocyte meiosis
hsa04340	Hedgehog signaling pathway
hsa04710	Circadian rhythm

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Male infertility	MIK: 30391586
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
30391586	Spermatogenesis defects, Male infertility				Male infertility