• Gene id: 8941

Gene Summary

• Gene Symbol: CDK5R2   Gene   UCSC   Ensembl
• Aliases: NCK5AI, P39, p39nck5ai
• Gene name: cyclin dependent kinase 5 regulatory subunit 2
• Alternate names: cyclin-dependent kinase 5 activator 2, CDK5 activator 2, cyclin-dependent kinase 5 activator isoform p39i, neuronal CDK5 activator isoform, p39I,
• Gene location: 2q35 (218959665: 218962154)     Exons: 1     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define
• OMIM: 610364

Protein Summary

• Protein general information: Q13319  
  • Name: Cyclin dependent kinase 5 activator 2 (CDK5 activator 2) (Cyclin dependent kinase 5 regulatory subunit 2) (p39) (p39I)
  • Length: 367  
  • Mass: 38705
  • Tissue specificity: Brain and neuron specific.
• Sequence:

  MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWKRLVAASAK
  KKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPSGGSAAAQPPGS
  GGGKPPPPPPPAPQVAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGW
  QDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
  IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKHWTMNLDR

• Structural information:
  • Interpro: IPR004944  IPR036915  
  • STRING: ENSP00000304250
• Other Databases: GeneCards:  CDK5R2  Malacards:  CDK5R2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	ISS	molecular function
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	TAS	molecular function
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	ISS	molecular function
GO:0043005	neuron projection	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0016533	protein kinase 5 complex	IEA	cellular component
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0045956	positive regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0021819	layer formation in cerebral cortex	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0001764	neuron migration	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	IEA	molecular function
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0021722	superior olivary nucleus maturation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0003779	actin binding	ISS	molecular function
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	TAS	molecular function
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	ISS	molecular function
GO:0043005	neuron projection	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0016020	membrane	ISS	cellular component
GO:0030426	growth cone	ISS	cellular component
GO:0016533	protein kinase 5 complex	IEA	cellular component
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0045956	positive regulation of calcium ion-dependent exocytosis	IEA	biological process
GO:0021819	layer formation in cerebral cortex	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0001764	neuron migration	IEA	biological process
GO:0030426	growth cone	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0061575	cyclin-dependent protein serine/threonine kinase activator activity	IEA	molecular function
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0021722	superior olivary nucleus maturation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0045737	positive regulation of cyclin-dependent protein serine/threonine kinase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881