• Gene id: 8935

Gene Summary

• Gene Symbol: SKAP2   Gene   UCSC   Ensembl
• Aliases: PRAP, RA70, SAPS, SCAP2, SKAP-HOM, SKAP55R
• Gene name: src kinase associated phosphoprotein 2
• Alternate names: src kinase-associated phosphoprotein 2, Fyn-associated phosphoprotein SKAP55 homologue, Pyk2/RAFTK-associated protein, SKAP-55HOM, SKAP55 homolog, retinoic acid-induced protein 70, src family-associated phosphoprotein 2, src kinase-associated phosphoprotein of 5,
• Gene location: 7p15.2 (26864622: 26654771)     Exons: 15     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating prop
• OMIM: 605215

Protein Summary

• Protein general information: O75563  
  • Name: Src kinase associated phosphoprotein 2 (Pyk2/RAFTK associated protein) (Retinoic acid induced protein 70) (SKAP55 homolog) (SKAP 55HOM) (SKAP HOM) (Src family associated phosphoprotein 2) (Src kinase associated phosphoprotein 55 related protein) (Src asso
  • Length: 359  
  • Mass: 41217
  • Tissue specificity: Ubiquitously expressed. Present in platelets (at protein level). {ECO
• Sequence:

  MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEY
  DDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFY
  YYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDI
  IPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYAN
  FYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI

• Structural information:
  • Protein Domains: (116..21-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (297..35-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR011993  IPR001849  IPR036028  IPR001452  IPR037781  
  • Prosite: PS50003 PS50002
  • PDB: 3OMH
  • PDBsum: 3OMH
  • STRING: ENSP00000005587
• Other Databases: GeneCards:  SKAP2  Malacards:  SKAP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042113	B cell activation	IEA	biological process
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05135	Yersinia infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881