• Gene id: 8934

Gene Summary

• Gene Symbol: RAB29   Gene   UCSC   Ensembl
• Aliases: RAB7L, RAB7L1
• Gene name: RAB29, member RAS oncogene family
• Alternate names: ras-related protein Rab-7L1, RAB7, member RAS oncogene family-like 1, rab-7-like protein 1, ras-related protein Rab-29,
• Gene location: 1q32.1 (205775486: 205767985)     Exons: 6     NC_000001.11
• OMIM: 603949

Protein Summary

• Protein general information: O14966  
  • Name: Ras related protein Rab 7L1 (Rab 7 like protein 1) (Ras related protein Rab 29)
  • Length: 203  
  • Mass: 23155
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTR
  LYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTG
  WTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC

• Structural information:
  • Interpro: IPR027417  IPR030697  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04107
  • PDB: 6HH2
  • PDBsum: 6HH2
  • DIP: 31215
  • STRING: ENSP00000356107
• Other Databases: GeneCards:  RAB29  Malacards:  RAB29

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007005	mitochondrion organization	IMP	biological process
GO:0009617	response to bacterium	IDA	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0017137	Rab GTPase binding	IDA	molecular function
GO:1901214	regulation of neuron death	ISS	biological process
GO:0070840	dynein complex binding	IDA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005801	cis-Golgi network	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0097708	intracellular vesicle	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0020003	symbiont-containing vacuole	IDA	cellular component
GO:0042110	T cell activation	IMP	biological process
GO:1901998	toxin transport	IMP	biological process
GO:0050862	positive regulation of T cell receptor signaling pathway	IMP	biological process
GO:0019894	kinesin binding	IPI	molecular function
GO:0007416	synapse assembly	IMP	biological process
GO:1903441	protein localization to ciliary membrane	ISS	biological process
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0072657	protein localization to membrane	IMP	biological process
GO:0039694	viral RNA genome replication	IMP	biological process
GO:0001921	positive regulation of receptor recycling	IMP	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0032438	melanosome organization	IBA	biological process
GO:0042470	melanosome	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0090316	positive regulation of intracellular protein transport	IMP	biological process
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	NOT|biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005802	trans-Golgi network	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0031982	vesicle	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005773	vacuole	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1905279	regulation of retrograde transport, endosome to Golgi	IEA	biological process
GO:0019003	GDP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005773	vacuole	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881