• Gene id: 8915

Gene Summary

• Gene Symbol: BCL10   Gene   UCSC   Ensembl
• Aliases: CARMEN, CIPER, CLAP, IMD37, c-E10, mE10
• Gene name: BCL10 immune signaling adaptor
• Alternate names: B-cell lymphoma/leukemia 10, B cell CLL/lymphoma 10, CARD containing molecule enhancing NF-kB, CARD-containing apoptotic signaling protein, CARD-containing molecule enhancing NF-kappa-B, CARD-containing proapoptotic protein, CED-3/ICH-1 prodomain homologous E10,
• Gene location: 1p22.3 (85276631: 85265775)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB.
• OMIM: 603517

Protein Summary

• Protein general information: O95999  
  • Name: B cell lymphoma/leukemia 10 (B cell CLL/lymphoma 10) (Bcl 10) (CARD containing molecule enhancing NF kappa B) (CARD like apoptotic protein) (hCLAP) (CED 3/ICH 1 prodomain homologous E10 like regulator) (CIPER) (Cellular homolog of vCARMEN) (cCARMEN) (Cell
  • Length: 233  
  • Mass: 26252
  • Tissue specificity: Ubiquitous.
• Sequence:

  MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQEN
  PKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRAS
  TVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPL
  RSRTVSRQ

• Structural information:
  • Protein Domains: (13..10-)
    (/note="CARD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00046"-)
  • Interpro: IPR033238  IPR001315  IPR042143  IPR011029  
  • Prosite: PS50209
  • CDD: cd08810
  • PDB: 2MB9 6BZE 6GK2
  • PDBsum: 2MB9 6BZE 6GK2
  • DIP: 29740
  • STRING: ENSP00000359612
• Other Databases: GeneCards:  BCL10  Malacards:  BCL10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032991	protein-containing complex	IDA	cellular component
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0043422	protein kinase B binding	IBA	molecular function
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IBA	biological process
GO:0002250	adaptive immune response	IBA	biological process
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0019209	kinase activator activity	IBA	contributes to
GO:0032449	CBM complex	IBA	cellular component
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0051059	NF-kappaB binding	IBA	molecular function
GO:0032449	CBM complex	IDA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0002250	adaptive immune response	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0016567	protein ubiquitination	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0050856	regulation of T cell receptor signaling pathway	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0043280	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0009620	response to fungus	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0002096	polkadots	IEA	cellular component
GO:0001783	B cell apoptotic process	IEA	biological process
GO:0001772	immunological synapse	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0070231	T cell apoptotic process	IEA	biological process
GO:0050870	positive regulation of T cell activation	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0016064	immunoglobulin mediated immune response	IEA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0006968	cellular defense response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0001843	neural tube closure	IEA	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0045121	membrane raft	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0033674	positive regulation of kinase activity	IEA	biological process
GO:0033674	positive regulation of kinase activity	IEA	biological process
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051059	NF-kappaB binding	IDA	molecular function
GO:0050852	T cell receptor signaling pathway	IDA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0019901	protein kinase binding	IDA	molecular function
GO:0019209	kinase activator activity	IDA	contributes to
GO:0008219	cell death	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0002906	negative regulation of mature B cell apoptotic process	IDA	biological process
GO:0002224	toll-like receptor signaling pathway	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0032094	response to food	IDA	biological process
GO:0005764	lysosome	IDA	cellular component
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IMP	biological process
GO:0045087	innate immune response	IEP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0042226	interleukin-6 biosynthetic process	NAS	biological process
GO:0042109	lymphotoxin A biosynthetic process	NAS	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0071222	cellular response to lipopolysaccharide	IEP	biological process
GO:0042802	identical protein binding	ISS	molecular function
GO:0043621	protein self-association	IPI	molecular function
GO:0032449	CBM complex	NAS	cellular component
GO:0019900	kinase binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001843	neural tube closure	ISS	biological process
GO:0050700	CARD domain binding	IPI	molecular function
GO:0043422	protein kinase B binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0032765	positive regulation of mast cell cytokine production	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002250	adaptive immune response	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa05152	Tuberculosis
hsa04064	NF-kappa B signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Combined immunodeficiency	KEGG:H00093
Combined immunodeficiency	KEGG:H00093
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray