• Gene id: 8914

Gene Summary

• Gene Symbol: TIMELESS   Gene   UCSC   Ensembl
• Aliases: TIM, TIM1, hTIM
• Gene name: timeless circadian regulator
• Alternate names: protein timeless homolog, Tof1 homolog, timeless circadian clock 1, timeless homolog,
• Gene location: 12q13.3 (56449425: 56416362)     Exons: 29     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is highly conserved and is involved in cell survival after damage or stress, increase in DNA polymerase epsilon activity, maintenance of telomere length, and epithelial cell morphogenesis. The encoded protein also plays a
• OMIM: 603887

Protein Summary

• Protein general information: Q9UNS1  
  • Name: Protein timeless homolog (hTIM)
  • Length: 1208  
  • Mass: 138658
  • Tissue specificity: Expressed in all tissues examined including brain, heart, lung, liver, skeletal muscle, kidney, placenta, pancreas, spleen, thymus and testis. Highest levels of expression in placenta, pancreas, thymus and testis. {ECO
• Sequence:

  MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRDVRQQLGAAQILQSDLLPILTQHHQD
  KPLFDAVIRLMVNLTQPALLCFGNLPKEPSFRHHFLQVLTYLQAYKEAFASEKAFGVLSETLYELLQLGWEERQE
  EDNLLIERILLLVRNILHVPADLDQEKKIDDDASAHDQLLWAIHLSGLDDLLLFLASSSAEEQWSLHVLEIVSLM
  FRDQNPEQLAGVGQGRLAQERSADFAELEVLRQREMAEKKTRALQRGNRHSRFGGSYIVQGLKSIGERDLIFHKG
  LHNLRNYSSDLGKQPKKVPKRRQAARELSIQRRSALNVRLFLRDFCSEFLENCYNRLMGSVKDHLLREKAQQHDE
  TYYMWALAFFMAFNRAASFRPGLVSETLSVRTFHFIEQNLTNYYEMMLTDRKEAASWARRMHLALKAYQELLATV
  NEMDISPDEAVRESSRIIKNNIFYVMEYRELFLALFRKFDERCQPRSFLRDLVETTHLFLKMLERFCRSRGNLVV
  QNKQKKRRKKKKKVLDQAIVSGNVPSSPEEVEAVWPALAEQLQCCAQNSELSMDSVVPFDAASEVPVEEQRAEAM
  VRIQDCLLAGQAPQALTLLRSAREVWPEGDVFGSQDISPEEEIQLLKQILSAPLPRQQGPEERGAEEEEEEEEEE
  EEELQVVQVSEKEFNFLDYLKRFACSTVVRAYVLLLRSYQQNSAHTNHCIVKMLHRLAHDLKMEALLFQLSVFCL
  FNRLLSDPAAGAYKELVTFAKYILGKFFALAAVNQKAFVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPE
  EEAHLRELYLANKDVEGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQRKGTHIVLWTGDQELELQRL
  FEEFRDSDDVLGHIMKNITAKRSRARIVDKLLALGLVAERRELYKKRQKKLASSILPNGAESLKDFCQEDLEEEE
  NLPEEDSEEEEEGGSEAEQVQGSLVLSNENLGQSLHQEGFSIPLLWLQNCLIRAADDREEDGCSQAVPLVPLTEE
  NEEAMENEQFQQLLRKLGVRPPASGQETFWRIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEH
  CKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRY
  QIEDDEDD

• Structural information:
  • Interpro: IPR006906  IPR007725  
  • PDB: 4XHT 4XHU 4XHW 5MQI
  • PDBsum: 4XHT 4XHU 4XHW 5MQI
  • DIP: 47395
  • STRING: ENSP00000450607
• Other Databases: GeneCards:  TIMELESS  Malacards:  TIMELESS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042127	regulation of cell population proliferation	IMP	NOT|biological process
GO:0000076	DNA replication checkpoint	IBA	biological process
GO:0006281	DNA repair	IBA	biological process
GO:0031298	replication fork protection complex	IBA	cellular component
GO:0048478	replication fork protection	IBA	biological process
GO:0000228	nuclear chromosome	IBA	cellular component
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0043111	replication fork arrest	IBA	biological process
GO:1905168	positive regulation of double-strand break repair via homologous recombination	IDA	biological process
GO:1905168	positive regulation of double-strand break repair via homologous recombination	IDA	biological process
GO:0035861	site of double-strand break	IDA	cellular component
GO:0035861	site of double-strand break	IDA	cellular component
GO:0042752	regulation of circadian rhythm	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological process
GO:1904976	cellular response to bleomycin	IMP	biological process
GO:0072719	cellular response to cisplatin	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0072711	cellular response to hydroxyurea	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:2000781	positive regulation of double-strand break repair	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007623	circadian rhythm	TAS	biological process
GO:0009582	detection of abiotic stimulus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048754	branching morphogenesis of an epithelial tube	IEA	biological process
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0002009	morphogenesis of an epithelium	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044770	cell cycle phase transition	IMP	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IC	cellular component
GO:0007623	circadian rhythm	ISS	biological process
GO:0002009	morphogenesis of an epithelium	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R