Male Infertility Database

Search Result

Gene id

891

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

CCNB1 Gene UCSC Ensembl

Aliases

CCNB

Gene name

cyclin B1

Alternate names

G2/mitotic-specific cyclin-B1,

Gene location

5q13.2 (69167009: 69178244) Exons: 9 NC_000005.10

Gene summary(Entrez)

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the

OMIM

123836

Protein Summary

Protein general information

P14635

Name: G2/mitotic specific cyclin B1

Length: 433 Mass: 48,337

Sequence

MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVI
DKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVI
LAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYM
TVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRP
LPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEES
LLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV

Structural information

Interpro:	IPR013763 IPR036915 IPR004367 IPR006671
Prosite:	PS00292
CDD:	cd00043
PDB:	2B9R 2JGZ 4Y72 4YC3 5HQ0 5LQF
PDBsum:	2B9R 2JGZ 4Y72 4YC3 5HQ0 5LQF
DIP:	59
MINT:
STRING:	ENSP00000256442

Other Databases

GeneCards: CCNB1 Malacards: CCNB1

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0000086	G2/M transition of mitoti c cell cycle	TAS	biological process
GO:0000922	spindle pole	IDA	cellular component
GO:0000942	condensed nuclear chromos ome outer kinetochore	IDA	cellular component
GO:0001556	oocyte maturation	IEA	biological process
GO:0001701	in utero embryonic develo pment	IEA	biological process
GO:0001933	negative regulation of pr otein phosphorylation	IEA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0005113	patched binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006461	protein complex assembly	IEA	biological process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological process
GO:0007052	mitotic spindle organizat ion	IMP	biological process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0007080	mitotic metaphase plate c ongression	IMP	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0009612	response to mechanical st imulus	IEA	biological process
GO:0010629	negative regulation of ge ne expression	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological process
GO:0031442	positive regulation of mR NA 3'-end processing	IEA	biological process
GO:0033129	positive regulation of hi stone phosphorylation	IEA	biological process
GO:0035173	histone kinase activity	IEA	molecular function
GO:0042246	tissue regeneration	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042787	protein ubiquitination in volved in ubiquitin-depen dent protein catabolic pr ocess	TAS	biological process
GO:0045931	positive regulation of mi totic cell cycle	IMP	biological process
GO:0046680	response to DDT	IEA	biological process
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological process
GO:0048565	digestive tract developme nt	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051436	negative regulation of ub iquitin-protein ligase ac tivity involved in mitoti c cell cycle	TAS	biological process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological process
GO:0051439	regulation of ubiquitin-p rotein ligase activity in volved in mitotic cell cy cle	TAS	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0051987	positive regulation of at tachment of spindle micro tubules to kinetochore	IMP	biological process
GO:0055015	ventricular cardiac muscl e cell development	IEA	biological process
GO:0060045	positive regulation of ca rdiac muscle cell prolife ration	IEA	biological process
GO:0060623	regulation of chromosome condensation	IEA	biological process
GO:0071283	cellular response to iron (III) ion	IEA	biological process
GO:0071398	cellular response to fatt y acid	IEA	biological process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological process
GO:0071456	cellular response to hypo xia	IEA	biological process
GO:0090266	regulation of mitotic cel l cycle spindle assembly checkpoint	IMP	biological process
GO:2000775	histone H3-S10 phosphoryl ation involved in chromos ome condensation	IEA	biological process
GO:0000086	G2/M transition of mitoti c cell cycle	TAS	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0000922	spindle pole	IDA	cellular component
GO:0000942	condensed nuclear chromos ome outer kinetochore	IDA	cellular component
GO:0001556	oocyte maturation	IEA	biological process
GO:0001701	in utero embryonic develo pment	IEA	biological process
GO:0001933	negative regulation of pr otein phosphorylation	IEA	biological process
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0005113	patched binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005815	microtubule organizing ce nter	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006461	protein complex assembly	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007052	mitotic spindle organizat ion	IMP	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0007080	mitotic metaphase plate c ongression	IMP	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0009612	response to mechanical st imulus	IEA	biological process
GO:0009636	response to toxic substan ce	IEA	biological process
GO:0010629	negative regulation of ge ne expression	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological process
GO:0031442	positive regulation of mR NA 3'-end processing	IEA	biological process
GO:0033129	positive regulation of hi stone phosphorylation	IEA	biological process
GO:0035173	histone kinase activity	IEA	molecular function
GO:0042246	tissue regeneration	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042787	protein ubiquitination in volved in ubiquitin-depen dent protein catabolic pr ocess	TAS	biological process
GO:0045787	positive regulation of ce ll cycle	IEA	biological process
GO:0045931	positive regulation of mi totic cell cycle	IMP	biological process
GO:0046680	response to DDT	IEA	biological process
GO:0048146	positive regulation of fi broblast proliferation	IEA	biological process
GO:0048565	digestive tract developme nt	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0051436	negative regulation of ub iquitin-protein ligase ac tivity involved in mitoti c cell cycle	TAS	biological process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological process
GO:0051439	regulation of ubiquitin-p rotein ligase activity in volved in mitotic cell cy cle	TAS	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0051987	positive regulation of at tachment of spindle micro tubules to kinetochore	IMP	biological process
GO:0055015	ventricular cardiac muscl e cell development	IEA	biological process
GO:0060045	positive regulation of ca rdiac muscle cell prolife ration	IEA	biological process
GO:0060623	regulation of chromosome condensation	IEA	biological process
GO:0071283	cellular response to iron (III) ion	IEA	biological process
GO:0071398	cellular response to fatt y acid	IEA	biological process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological process
GO:0071456	cellular response to hypo xia	IEA	biological process
GO:0090266	regulation of mitotic cel l cycle spindle assembly checkpoint	IMP	biological process
GO:2000775	histone H3-S10 phosphoryl ation involved in chromos ome condensation	IEA	biological process
GO:0000086	G2/M transition of mitoti c cell cycle	TAS	biological process
GO:0000922	spindle pole	IDA	cellular component
GO:0000942	condensed nuclear chromos ome outer kinetochore	IDA	cellular component
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0004693	cyclin-dependent protein serine/threonine kinase a ctivity	TAS	molecular function
GO:0005113	patched binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, sign al transduction by p53 cl ass mediator resulting in cell cycle arrest	TAS	biological process
GO:0007052	mitotic spindle organizat ion	IMP	biological process
GO:0007077	mitotic nuclear envelope disassembly	TAS	biological process
GO:0007080	mitotic metaphase plate c ongression	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0031145	anaphase-promoting comple x-dependent catabolic pro cess	TAS	biological process
GO:0042787	protein ubiquitination in volved in ubiquitin-depen dent protein catabolic pr ocess	TAS	biological process
GO:0045931	positive regulation of mi totic cell cycle	IMP	biological process
GO:0051436	negative regulation of ub iquitin-protein ligase ac tivity involved in mitoti c cell cycle	TAS	biological process
GO:0051437	positive regulation of ub iquitin-protein ligase ac tivity involved in regula tion of mitotic cell cycl e transition	TAS	biological process
GO:0051439	regulation of ubiquitin-p rotein ligase activity in volved in mitotic cell cy cle	TAS	biological process
GO:0051726	regulation of cell cycle	TAS	biological process
GO:0051987	positive regulation of at tachment of spindle micro tubules to kinetochore	IMP	biological process
GO:0090266	regulation of mitotic cel l cycle spindle assembly checkpoint	IMP	biological process

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa04068	FoxO signaling pathway
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa04115	p53 signaling pathway
hsa04218	Cellular senescence
hsa04914	Progesterone-mediated oocyte maturation
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Expand All | Collapse All

Associated diseases	References
Cancer (ovarian)	GAD: 19738611
Cancer (esophageal)	GAD: 20453000
Cancer (breast)	GAD: 20508983
Endometriosis	INFBASE: 18353325
Female infertility	INFBASE: 17425849
Male factor infertility	MIK: 16155078
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male infertility	MIK: 16155078
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
16155078	Male infer tility	37 azoospermic patients	Male infertility	CDC2 CCNB1 CCNB2 CDC25A CDC25B CDC25C and WEE1	Show abstract
26404029	May contri bute to oc currence a nd develop ment of te ratozoospe rmia, Male infertili ty		Male infertility		Show abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
31037746	Spermatoge nic defect s	28 men with az oospermia	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All