• Gene id: 8908

Gene Summary

• Gene Symbol: GYG2   Gene   UCSC   Ensembl
• Aliases: GN-2, GN2
• Gene name: glycogenin 2
• Alternate names: glycogenin-2, glycogenin glucosyltransferase,
• Gene location: Xp22.33 (2828711: 2882819)     Exons: 14     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation reactions of glycogen biosynthesis. A gene on chromosome 3 encodes the muscle glycogenin and this X-linked gene encodes the glyc
• OMIM: 300198

Protein Summary

• Protein general information: O15488  
  • Name: Glycogenin 2 (GN 2) (GN2) (EC 2.4.1.186)
  • Length: 501  
  • Mass: 55184
  • Tissue specificity: Detected in liver (at protein level) (PubMed
• Sequence:

  MSETEFHHGAQAGLELLRSSNSPTSASQSAGMTVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQ
  VSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDR
  GEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSN
  TMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSASSSQHQAAFLHLWWTVYQNNVLPLYKSVQA
  GEARASPGHTLCHSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRS
  EDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVD
  LAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ

• Structural information:
  • Interpro: IPR002495  IPR029044  
  • PDB: 4UEG
  • PDBsum: 4UEG
  • STRING: ENSP00000370555
• Other Databases: GeneCards:  GYG2  Malacards:  GYG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005978	glycogen biosynthetic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0008466	glycogenin glucosyltransferase activity	IBA	molecular function
GO:0005978	glycogen biosynthetic process	IDA	biological process
GO:0008466	glycogenin glucosyltransferase activity	IDA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005978	glycogen biosynthetic process	IEA	biological process
GO:0102751	UDP-alpha-D-glucose:glucosyl-glycogenin alpha-D-glucosyltransferase activity	IEA	molecular function
GO:0008466	glycogenin glucosyltransferase activity	IEA	molecular function
GO:0008466	glycogenin glucosyltransferase activity	EXP	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005978	glycogen biosynthetic process	TAS	biological process
GO:0005978	glycogen biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00500	Starch and sucrose metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881