• Gene id: 8905

Gene Summary

• Gene Symbol: AP1S2   Gene   UCSC   Ensembl
• Aliases: DC22, MRX59, MRXS21, MRXS5, MRXSF, PGS, SIGMA1B
• Gene name: adaptor related protein complex 1 subunit sigma 2
• Alternate names: AP-1 complex subunit sigma-2, adapter-related protein complex 1 sigma-1B subunit, adaptor protein complex AP-1 sigma-1B subunit, adaptor related protein complex 1 sigma 2 subunit, adaptor-related protein complex 1 subunit sigma-1B, clathrin adaptor complex AP1,
• Gene location: Xp22.2 (67600301: 67589305)     Exons: 5     NC_000014.9
• Gene summary(Entrez): Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembra
• OMIM: 300629

Protein Summary

• Protein general information: P56377  
  • Name: AP 1 complex subunit sigma 2 (Adaptor protein complex AP 1 subunit sigma 1B) (Adaptor related protein complex 1 subunit sigma 1B) (Clathrin assembly protein complex 1 sigma 1B small chain) (Golgi adaptor HA1/AP1 adaptin sigma 1B subunit) (Sigma 1B subunit
  • Length: 157  
  • Mass: 18615
  • Tissue specificity: Widely expressed.
• Sequence:

  MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDN
  ELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSV
  LEEIGLT

• Structural information:
  • Interpro: IPR016635  IPR022775  IPR000804  IPR011012  
  • Prosite: PS00989
  • STRING: ENSP00000444957
• Other Databases: GeneCards:  AP1S2  Malacards:  AP1S2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0030117	membrane coat	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030119	AP-type membrane coat adaptor complex	TAS	cellular component
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05170	Human immunodeficiency virus 1 infection
hsa04142	Lysosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)