• Gene id: 8900

Gene Summary

• Gene Symbol: CCNA1   Gene   UCSC   Ensembl
• Aliases: CT146
• Gene name: cyclin A1
• Alternate names: cyclin-A1, testicular tissue protein Li 34,
• Gene location: 13q13.3 (36430487: 36442881)     Exons: 11     NC_000013.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
• OMIM: 604036

Protein Summary

• Protein general information: P78396  
  • Name: Cyclin A1
  • Length: 465  
  • Mass: 52,358
• Sequence:

  METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLG
  QDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSC
  SVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIR
  HRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKY
  EEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLE
  ADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKY
  LCVSLMEPPAVLLLQ

• Structural information:
  • Interpro: IPR013763  IPR036915  IPR004367  IPR006671  
  • Prosite: PS00292
  • CDD: cd00043
  • STRING: ENSP00000255465
• Other Databases: GeneCards:  CCNA1  Malacards:  CCNA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007141	male meiosis I	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007141	male meiosis I	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007141	male meiosis I	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04152	AMPK signaling pathway
hsa04110	Cell cycle
hsa04218	Cellular senescence
hsa04914	Progesterone-mediated oocyte maturation
hsa05200	Pathways in cancer
hsa05202	Transcriptional misregulation in cancer
hsa05203	Viral carcinogenesis
hsa05221	Acute myeloid leukemia
hsa05166	Human T-cell leukemia virus 1 infection
hsa05161	Hepatitis B
hsa05169	Epstein-Barr virus infection
hsa05165	Human papillomavirus infection

Diseases

Associated diseases	References
Cancer (ovarian)	GAD: 19738611
Azoospermia	MIK: 19886767
Male factor infertility	MIK: 19886767
Spermatogenesis defects	MIK: 12202422
Spermatogenesis defects	MIK: 12202422
Male factor infertility	MIK: 19886767
Oligozoospermia	MIK: 19886767
Oligozoospermia	MIK: 19886767
Azoospermia	MIK: 19886767
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 12579332
Male infertility	MIK: 15047941
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Severe oligozoospermia	MIK: 19886767
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19886767	Male infertility, azoospermia or severe oligozoospermia	c.321T>C, IVS3 +32G>C, IVS5+38A>G and c.1158G>A		557 (347 infertile patients with azoospermia or severe oligozoospermia, 210 fertile controls)	Male infertility	Cyclin A1
12202422	Spermatogenic disorders			38 (12 non-obstructive azoospermia, 17 maturation arrest, 9 Sertoli cell-only syndrome (SCOS))	Male infertility	cyclin A1
15047941	Assocaited with male sterility				Male infertility
12579332	Active in early stages of spermatogenesis				Male infertility
12121569	Predicts meiotic disorders during spermatogenesis				Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray